KEGG   Arthrobacter arilaitensis: AARI_07340Help
Entry
AARI_07340        CDS       T01320                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
aai  Arthrobacter arilaitensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AARI_07340 (deoA)
Enzymes [BR:aai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     AARI_07340 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
817524..818837
Genome map
AA seq 437 aa AA seqDB search
MATEQFSAVEVIRAKRDGQVLGNEMIDWTIDAYTRGAIAEEQMSALNMAIYFQGMNRSEI
SRWTNAMINSGERMDFSTLADPSGKHLATTDKHSTGGVGDKITLPLAPLVASFGVAVPQL
SGRGLGHTGGTLDKLEAIPGWKAELSNEALFDQLSTVGAVICAAGTGLAPADKKLYALRD
VTATVEAIPLIASSIMSKKIAEGTGTLVLDVKVGSGAFMKDEAMSRELAETMVNLGTDAG
VNTVALLTNMETPLGLTAGNAIEVEESVEVLAGGGPQDVIELTVALATEMLAGAGIKDVD
VAGALKNGQAMDVWRKMIAAQGGDPDAKLPVAKESHTVVAPAEGVLLKLDAMDIGLAAWT
LGAGRARKEDSVQAGAGVRMHVKPGALVRRGEPIATLLTDTPEKMERAIELVQRAIMVGS
ADDRPDTRLILDRIAAK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgagcaattcagtgccgtcgaggtcatccgcgccaagcgcgatggccaagta
ctgggcaacgagatgatcgactggaccatcgacgcctacacccgcggggccatcgccgaa
gagcagatgtccgccttgaacatggccatctacttccagggcatgaaccgcagcgagatc
tcgcgctggaccaacgcgatgatcaactccggagaacgcatggacttctccacccttgca
gacccttcgggcaagcacctggccaccaccgacaagcactccaccggtggcgtgggggac
aagatcaccttgcccctggcaccgctggtcgccagcttcggcgtggccgtcccgcagctc
tcgggccgcggactgggccacaccggcggcactttggacaagctcgaagccatcccgggc
tggaaggctgagttgtccaacgaagcgctgttcgaccagctctccaccgtcggcgcggtc
atttgcgcagctggcaccggactggccccggcagataagaagctgtacgcgctgcgcgat
gtcaccgcgaccgtggaagcgatcccgctgatcgcctcctcgatcatgagcaagaagatc
gccgaaggcaccggcaccctggtgctggatgtgaaggtcggttccggcgcgttcatgaag
gacgaggccatgtcccgcgagctggccgaaaccatggtgaacctgggcaccgatgccggg
gtgaacaccgtggcgctgctgaccaatatggaaaccccgctggggttgactgcaggcaac
gcgatcgaggtcgaggaatccgtcgaggtcctggccggcggcgggccgcaggacgtcatt
gagctgaccgtggcgctggctaccgagatgctggctggtgccggaatcaaggatgtcgat
gttgccggtgcgctgaagaacggccaggccatggacgtgtggcgcaagatgatcgctgcc
cagggcggcgacccggatgccaagttgccggtggccaaggaatcgcacaccgtggtggca
cctgccgagggcgtgctgctcaagctggatgccatggacatcggcttggccgcctggacc
ttgggcgcgggccgtgcccgcaaggaagacagcgtccaggcgggcgcgggcgtgcgcatg
catgtgaagccaggagccttggtgcgccgtggcgagcctattgccacgttgctgaccgat
accccggaaaagatggagcgcgccattgaactggtccagcgagccatcatggtcggttcg
gccgatgaccgtccggacacccgcctgatcttggatcgcatcgcggccaagtag

DBGET integrated database retrieval system