KEGG   Glutamicibacter arilaitensis Re117: AARI_07900Help
Entry
AARI_07900        CDS       T01320                                 

Gene name
ispE
Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
aai  Glutamicibacter arilaitensis Re117
Pathway
aai00900  Terpenoid backbone biosynthesis
aai01100  Metabolic pathways
aai01110  Biosynthesis of secondary metabolites
aai01130  Biosynthesis of antibiotics
Module
aai_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AARI_07900 (ispE)
Enzymes [BR:aai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     AARI_07900 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: CBT75011
UniProt: E1VTQ8
Position
883803..884735
Genome map
AA seq 310 aa AA seqDB search
MSKQHVIATAPGKINCYFKVGPPREDGYHEVASLYVAVSLTEQIEATLRTDGELLLSLEP
DSPVVSEPENFPLGSNNLVHQAAELLREHTGCTLGADLHITKRVPIAGGMGGGSADAAAT
LVACNELWGTGLDREELGRLGARLGADVPFALMGGAAIGLGIGDKLAPLLTRGKTHWVLI
PASYGLSTPRVYGMLDRLRSGTEVEVPQEIDPAVIEALMASDAPALSQVLANDLTQASLA
LAPELGTMRDMAEGAGALRAMVSGSGPTLALLVKDGEHAQEVMAQLGDEVGVATIPVTAP
AAGAHIILSE
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcagcatgtaattgccaccgcaccgggcaagatcaactgctatttcaaggta
ggccctccgcgtgaggatggctaccatgaagtcgccagcctctacgtggcggtttccctg
accgaacagatcgaggcgaccctgcgcaccgatggggaactgctgctgagcttggagcct
gattctccggtggtctcggaaccggagaactttccgctggggtccaataacctggtgcat
caagcagcagaactgctgcgggagcataccggctgtaccctcggagcggacctgcacatc
accaagcgggtgccgattgccggtggcatgggtggcggctccgctgatgcagcagccacc
ctggtggcgtgcaatgagctgtggggaaccgggctggaccgcgaggaactgggccgcttg
ggcgcacgcctaggggctgacgtaccctttgccttgatgggtggagcggccatcggcctg
ggcatcggggacaaactggccccgctgctgacccggggaaagacccattgggtgctgatc
ccagccagctacggcctgtcgactccgcgagtctacggcatgcttgatcgcctgcgttca
ggcaccgaagttgaagtcccccaagaaatcgacccagcggttatcgaagcgctgatggct
tcggatgcaccagcgttatcccaggtgctcgccaacgacctgacccaggcttccttggca
ctggctccagaactgggcaccatgcgcgatatggcggaaggtgccggcgccctgcgtgcc
atggtttccggctcagggccaactctggcgctgctggtcaaggatggagaacatgcccaa
gaggtcatggcccagctcggtgacgaggtaggcgttgccaccattccggtcactgctcca
gctgccggtgcgcacatcatcttgtctgaatga

DBGET integrated database retrieval system