KEGG   Arthrobacter arilaitensis: AARI_09960Help
Entry
AARI_09960        CDS       T01320                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose-5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
aai  Arthrobacter arilaitensis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AARI_09960 (dxr)
Enzymes [BR:aai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     AARI_09960 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1118594..1119817
Genome map
AA seq 407 aa AA seqDB search
MDWVSSQKTFIPAGHPRRVSLIGSTGSIGTQGLDVIDGAPELFTVAAISGGYNLERLAQQ
AVKHRPALVGSAVESKEELARAIQQAAEQASVSGYAPELAVGELAATEVAAYTEADVVLN
GITGAIGLAPTIAALEAGHLLALANKESLIIGGQVVKQIAAPGQISPVDSEHSALAQALR
SGAPEEVAKLLVTASGGPFFGYSYEQLRNVTPAQALAHPTWDMGRMVTTNSATMVNKALE
VIEAHLLFDVPLEKIEPVVHRQSIIHSMVEFIDGSVIAQASPPDMRLPIALGINWPHRVP
GAAKACDFSTAASWTFEPLDEEVFTAVKLAKQAASASGTHMALYNAANEVAVDAFHDGKI
GFTDIVETIERVLNEYTPASDELSVATVMDTDRWARAHAAKIVEAKA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggattgggtgagctcccagaaaactttcattccagccggacacccacgccgggtcagc
ctgatcggttccaccggttccatcggcacccaagggttggacgtcatcgacggcgcccca
gaactcttcacggtggctgccatcagcggtggctacaaccttgaacggctcgcgcagcag
gcagtcaagcaccgtcccgccttggttggcagtgctgttgaatccaaggaagagctcgca
agagcaatccagcaggctgcagaacaggcttccgtgagcggctatgcaccggaactggcg
gtcggcgagctcgctgccaccgaggtggcggcgtacaccgaagccgatgtggtgctcaac
ggaattaccggtgccattggactggctccgaccatcgcagctttggaagcagggcatttg
ctggccctggccaacaaggaatccctgattatcggcggacaggtagtcaagcagatcgcg
gcccccggccagatctcaccggtggattcggagcattcggcgttggcccaggcgctgcgt
tctggtgctcctgaagaagtagccaagttgctggtcaccgcctccggtggcccgttcttc
ggctacagctacgagcagctgcgcaacgtcaccccagcgcaggcactggctcaccctact
tgggacatgggacgcatggtgaccactaactcggccacgatggtcaataaggcactggaa
gtcatcgaagcccacctgctctttgacgtgccgctggaaaagattgaacctgttgtgcac
cgccaatccatcatccattccatggtggagttcatcgacggatcggtcatcgcgcaggcc
tcgccgccggatatgcgcctgccaatcgccttgggcatcaattggccccaccgtgtgccc
ggggctgccaaggcctgcgatttctccaccgcggcaagctggactttcgaaccgttggat
gaggaagtcttcaccgccgtcaaactggctaagcaggccgcctctgcttccggtactcac
atggccctctacaacgcagccaacgaagttgccgtggatgcgttccatgacggaaagatc
ggcttcaccgacatcgtggaaaccattgaacgcgtactgaacgaatacactccggccagc
gatgagctatcggttgcaacggtgatggacacggaccgttgggcccgagcccatgccgca
aagatcgtggaggccaaggcgtga

DBGET integrated database retrieval system