KEGG   Glutamicibacter arilaitensis Re117: AARI_09960Help
Entry
AARI_09960        CDS       T01320                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
aai  Glutamicibacter arilaitensis Re117
Pathway
aai00900  Terpenoid backbone biosynthesis
aai01100  Metabolic pathways
aai01110  Biosynthesis of secondary metabolites
aai01130  Biosynthesis of antibiotics
Module
aai_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AARI_09960 (dxr)
Enzymes [BR:aai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     AARI_09960 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C FCD
Motif
Other DBs
NCBI-ProteinID: CBT75213
UniProt: E1VUB1
Position
1118594..1119817
Genome map
AA seq 407 aa AA seqDB search
MDWVSSQKTFIPAGHPRRVSLIGSTGSIGTQGLDVIDGAPELFTVAAISGGYNLERLAQQ
AVKHRPALVGSAVESKEELARAIQQAAEQASVSGYAPELAVGELAATEVAAYTEADVVLN
GITGAIGLAPTIAALEAGHLLALANKESLIIGGQVVKQIAAPGQISPVDSEHSALAQALR
SGAPEEVAKLLVTASGGPFFGYSYEQLRNVTPAQALAHPTWDMGRMVTTNSATMVNKALE
VIEAHLLFDVPLEKIEPVVHRQSIIHSMVEFIDGSVIAQASPPDMRLPIALGINWPHRVP
GAAKACDFSTAASWTFEPLDEEVFTAVKLAKQAASASGTHMALYNAANEVAVDAFHDGKI
GFTDIVETIERVLNEYTPASDELSVATVMDTDRWARAHAAKIVEAKA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggattgggtgagctcccagaaaactttcattccagccggacacccacgccgggtcagc
ctgatcggttccaccggttccatcggcacccaagggttggacgtcatcgacggcgcccca
gaactcttcacggtggctgccatcagcggtggctacaaccttgaacggctcgcgcagcag
gcagtcaagcaccgtcccgccttggttggcagtgctgttgaatccaaggaagagctcgca
agagcaatccagcaggctgcagaacaggcttccgtgagcggctatgcaccggaactggcg
gtcggcgagctcgctgccaccgaggtggcggcgtacaccgaagccgatgtggtgctcaac
ggaattaccggtgccattggactggctccgaccatcgcagctttggaagcagggcatttg
ctggccctggccaacaaggaatccctgattatcggcggacaggtagtcaagcagatcgcg
gcccccggccagatctcaccggtggattcggagcattcggcgttggcccaggcgctgcgt
tctggtgctcctgaagaagtagccaagttgctggtcaccgcctccggtggcccgttcttc
ggctacagctacgagcagctgcgcaacgtcaccccagcgcaggcactggctcaccctact
tgggacatgggacgcatggtgaccactaactcggccacgatggtcaataaggcactggaa
gtcatcgaagcccacctgctctttgacgtgccgctggaaaagattgaacctgttgtgcac
cgccaatccatcatccattccatggtggagttcatcgacggatcggtcatcgcgcaggcc
tcgccgccggatatgcgcctgccaatcgccttgggcatcaattggccccaccgtgtgccc
ggggctgccaaggcctgcgatttctccaccgcggcaagctggactttcgaaccgttggat
gaggaagtcttcaccgccgtcaaactggctaagcaggccgcctctgcttccggtactcac
atggccctctacaacgcagccaacgaagttgccgtggatgcgttccatgacggaaagatc
ggcttcaccgacatcgtggaaaccattgaacgcgtactgaacgaatacactccggccagc
gatgagctatcggttgcaacggtgatggacacggaccgttgggcccgagcccatgccgca
aagatcgtggaggccaaggcgtga

DBGET integrated database retrieval system