KEGG   Arthrobacter arilaitensis: AARI_12030Help
Entry
AARI_12030        CDS       T01320                                 

Definition
esterase/lipase (EC:3.1.1.-)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
aai  Arthrobacter arilaitensis
Brite
Enzymes [BR:aai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     AARI_12030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1339843..1340616)
Genome map
AA seq 257 aa AA seqDB search
MKLDTQDIAPEGRKRSDAVLLIHGFTGSPISMQPWASSLEQAGFDTAIPLLPGHGTQWKD
MIGCDYGQWIHATEQAYDLLAQTHERVFAAGLSMGGALALHLATRRNVAGVSLVNPGLVV
DSPVAPYTPWLKHVVRSVAPISDDIAKRGVTEGAYPRTPVAAVAQLHSLFAQTRRRLALV
DAPVQLFRSTVDNVVSERSVHELVEGLNSGTLAEHHMLLHSKHVATLDYDAEQIFHESAR
FFAQLAAAEHKPKQERP
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgatacacaagatattgcaccggaggggcgaaaacgctccgatgcggtgcta
ctgatccatggtttcaccggttctcctatttctatgcagccctgggccagctctttggag
caggccgggttcgatacggctatcccattgctgcccggtcatggaacgcagtggaaggac
atgatcggttgcgattatggccaatggatccatgccaccgaacaggcctatgatctgctg
gcccagacccatgaacgggtgtttgccgctggcttgtccatgggcggggccttggccttg
catttggcaactcgccgcaatgtggccggggtgtcgctggtcaacccgggcctggtcgtg
gactcccccgtcgccccctacacaccgtggctcaagcatgtggtgcgcagtgttgccccg
atcagcgatgacattgccaagcgcggtgtcaccgagggtgcctacccacgcacgccggtt
gcggcagtggcccaattgcactcgctctttgcacagacccggcgccgcttggcattggtg
gacgctccggtgcagctcttccgatcgaccgttgacaacgtggtttccgagcgttcggtg
cacgaactggtcgaagggttgaactcaggcaccctggccgagcaccatatgctgctgcat
tccaagcacgtagccaccttggactacgacgccgaacagattttccacgaatcggctcga
ttcttcgcacaactggccgcagcggaacataagcctaagcaggagcgcccatga

DBGET integrated database retrieval system