KEGG   Arthrobacter arilaitensis: AARI_12600Help
Entry
AARI_12600        CDS       T01320                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aai  Arthrobacter arilaitensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AARI_12600 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AARI_12600 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AARI_12600 (thrC)
Enzymes [BR:aai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AARI_12600 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1403229..1404329
Genome map
AA seq 366 aa AA seqDB search
MAHQWRGVIREYADRLPVNENTKVITLGEGGTPLVYAPALSAHTGNEVYLKVEGMNPTGS
FKDRGMTMAMTAAVAAGAKAVVCASTGNTSASAAAYATQAGLKCAVLVPDGKISMGKMSQ
AIAHGADIIQIDGNFDNCLEVARKLSENYPVFLVNSVNPARIQGQKTGAFEVVDFLGDAP
DYHLLPVGNAGNITAYWKGYKEYSTEWTNEAGKVLEPVSTKNPIMWGFQAAGAAPIVAGH
PITEPDTIATAIRIGNPASWEQAEVARDESGGQIDSVTDEQILEAHRWLSSREGVFVEPA
SAAGVAGLLKHHAAGNVPTGKKIVITVTGHGLKDPDWALKQSDGSDVAPKKVALDVVEVA
GALGLA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaccagtggcgcggagtaatccgcgaatatgccgatcgcctgccagtgaacgaa
aataccaaggtcatcaccctgggcgaaggcggcaccccgttggtctacgcaccggcgctg
tcggcccataccggcaatgaggtgtacctgaaggtcgagggcatgaacccgaccggctcc
ttcaaggaccgtggcatgaccatggcgatgaccgccgcggtagccgccggcgcgaaggcc
gtggtctgcgcctccaccggcaacacctcggcttcggccgcggcctacgccacccaggcc
ggcctgaagtgcgccgtgctggtaccggatggcaagatctccatgggcaagatgtcccag
gcgatcgcccacggcgcggacatcatccagatcgacggcaacttcgataactgccttgag
gtcgcccgcaagctcagcgagaactacccggtattcctggtcaactcggtgaaccctgcg
cgtatccagggccagaagaccggcgccttcgaggtcgtggacttcctgggcgacgcacct
gactaccacctgctgccagtaggcaacgcgggcaacatcaccgcgtactggaagggctac
aaggagtactccactgagtggaccaacgaggccggcaaggtcctcgaaccggtatccacc
aagaacccgatcatgtggggcttccaggcagctggtgccgctccgattgttgccgggcac
ccgatcaccgaaccggacaccatcgccaccgcgatccgcatcggcaacccggcttcctgg
gaacaggccgaagtagcccgcgacgagtccggcggccagatcgactcggtcaccgatgag
cagatccttgaagcccaccgctggctctcctcgcgcgaaggcgtgttcgtggagcctgct
tcggcagccggcgtggccggcctgctcaagcaccacgcagcgggcaacgtcccgaccgga
aaaaagatcgtgatcaccgtaaccggccacggcctgaaggacccggactgggccctgaag
cagtccgacggctcggacgtcgcaccaaagaaggtggccttggacgtagtcgaggttgcc
ggcgccctgggcctggcctaa

DBGET integrated database retrieval system