KEGG   Arthrobacter arilaitensis: AARI_14370Help
Entry
AARI_14370        CDS       T01320                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
aai  Arthrobacter arilaitensis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:aai00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:aai00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1637693..1639012
Genome map
AA seq 439 aa AA seqDB search
MGKILTIHGGVPLKGTVRVGGAKNLVPKAMVAALLGDTPSVLRNVPEIKDVAVVRSLLEI
HGVKVDQDPETGDLTMDPTQVKIASNQAIDAHAGDSRIPILFCGPLIHALGEAFIPDLGG
CRIGDRPIDFHLEVLRDFGAIVDKAADGIRISAPNGLTGAKVELQYPSVGTTEQVLLSAV
RAKGVTEVSNAAIEPEILDLISLLQKMGAIISVHRDRVIRIQGVEKLSGFDHSAMPDRNE
AASWASAALVTKGDIFVQDATQRDLTAFLHVYRQIGGEFDVKSDGIRFYHPGGDLNPLIL
ETDVHPGFMTDWQQPLVVALTQAKGVSVIHETVYENRFGFTDALVRMGSTVQVHTDCLGS
TPCRFGQRNFKHSAVVVGPAKLTGADIDVPDLRGGFSHLIAALAAEGTSKVTGIEIINRG
YEHFMEKLQALGANVELSN
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagatcctgacgatccatggtggtgtcccgctcaagggcaccgtacgagtcggc
ggagcaaagaacctagtgccaaaagccatggtcgcggctctgcttggcgataccccttcg
gtattgcgcaacgtaccggagatcaaagatgtagctgtcgtgcgcagcctccttgaaatc
cacggtgtcaaggttgaccaggaccctgaaaccggcgatctgaccatggaccctacccag
gtcaagatcgcctcgaaccaggcgatcgatgcccatgccggtgactcgcgtatccctatt
cttttctgcggaccattgatccacgccttgggcgaagcgttcatcccggatctgggtggc
tgccgcatcggcgaccgtccgattgacttccacctggaagtgctgcgcgactttggagcg
atcgttgacaaggcagccgatggcatccgcatctcggcccctaatgggctgaccggcgcc
aaggttgaactgcaatacccaagtgttggcaccaccgaacaggtcctgctctcggccgtt
cgagccaagggtgtcaccgaggtcagcaacgcggccattgagccagaaatccttgacctg
atctcgcttctgcagaaaatgggcgcgattatctccgtgcaccgtgatcgcgtaatccgc
attcagggtgtcgagaagctctccggctttgaccactccgctatgcctgaccgcaatgag
gccgcttcgtgggcctctgccgcgctggtcaccaagggagatatttttgttcaggacgcc
acccagcgcgacttgaccgctttccttcacgtataccgccaaatcggtggcgaattcgac
gtcaagagcgacggcattcgcttctatcaccccggtggagatttgaatccgctgattttg
gaaaccgacgttcaccccggattcatgaccgactggcagcaaccactggtcgttgcgttg
acgcaggcaaagggtgtctcggtaatccacgagaccgtatacgagaaccgctttggcttt
actgatgctttggttcggatgggatctaccgtccaggtgcacactgactgcctcggctcc
accccttgccgctttggccagcgcaacttcaagcactcagctgtagttgtgggccctgca
aagctgaccggtgccgatattgacgttccagatcttcggggcggtttctcccacttgatc
gctgccttagcggccgaagggaccagcaaggtcaccggtattgagatcatcaaccgagga
tacgagcacttcatggagaagctgcaagccttgggtgcaaacgtcgagctgagcaactaa

DBGET integrated database retrieval system