KEGG   Glutamicibacter arilaitensis Re117: AARI_14490Help
Entry
AARI_14490        CDS       T01320                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aai  Glutamicibacter arilaitensis Re117
Pathway
aai00040  Pentose and glucuronate interconversions
aai00052  Galactose metabolism
aai00500  Starch and sucrose metabolism
aai00520  Amino sugar and nucleotide sugar metabolism
aai01100  Metabolic pathways
aai01130  Biosynthesis of antibiotics
Module
aai_M00362  Nucleotide sugar biosynthesis, prokaryotes
aai_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AARI_14490 (galU)
   00052 Galactose metabolism
    AARI_14490 (galU)
   00500 Starch and sucrose metabolism
    AARI_14490 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    AARI_14490 (galU)
Enzymes [BR:aai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AARI_14490 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: CBT75662
UniProt: E1VVK9
Position
1650104..1651003
Genome map
AA seq 299 aa AA seqDB search
MPKSAITKAVIPAAGLGTRFLPATKAMPKEMLPVVDKPAIQYVVAEAVKSGFTDLLMVTG
RNKRALEDHFDRVPSLEYSLEAKGDKKKLDAIHEATRLGDIHYVRQGDPRGLGHAVLCAK
QHVGNEPFAVLLGDDLIDERDELLSVMAEVQRKTGGSVIALMEVEPEQISAYGCADVSLV
ESEDFVKVNALVEKPEINEAPSNLAIIGRYLLHPRVFEVLEHTAPGRGNEIQLTDALQIL
AAAHGEGAGVHAVIFRGRRYDTGDKLSYLQANITLAVENDELGPSLKSWLKGFVNQLAD
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagtcggctattactaaggcagtgattccagcggcaggcttgggcactcgattc
ctacctgcaacgaaggcaatgcctaaagagatgttgccggttgtcgataagccagccatt
caatacgtagtcgcagaagccgttaagtccggtttcactgacttgctgatggttactggt
cgtaataaacgtgctcttgaagatcacttcgatcgtgttccgtcgctcgaatactcgtta
gaagcgaagggcgacaagaagaagcttgacgcgattcatgaggccactcgcctaggtgat
atccactatgtacgccagggcgatccacgcggcctaggacatgctgtcctgtgtgccaag
cagcatgtaggcaacgaaccgttcgctgttctattaggcgatgacttgattgacgagcgt
gacgagctgctgtccgtcatggccgaggttcaacggaaaactggtggttccgtcattgcg
ctgatggaagtggagccggaacaaatcagtgcgtacggatgtgccgatgtctccctggtg
gaaagcgaagactttgttaaagtcaacgctctcgtcgaaaagcccgagatcaacgaggca
ccaagcaacctggcaattattggtaggtaccttcttcatccacgtgtgtttgaagtcttg
gagcacacggcacccggtcgtggaaacgaaatccagcttacagatgcgttgcagatactc
gctgcggcacatggcgaaggcgccggagtgcatgcagtcattttccgtggacgccgttat
gatactggcgacaagctcagctatctgcaggcaaatattacattggccgttgagaacgat
gaactgggaccaagtctaaaatcgtggctcaaaggatttgtcaatcagctagcggactag

DBGET integrated database retrieval system