KEGG   Arthrobacter arilaitensis: AARI_14490Help
Entry
AARI_14490        CDS       T01320                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aai  Arthrobacter arilaitensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AARI_14490 (galU)
   00052 Galactose metabolism
    AARI_14490 (galU)
   00500 Starch and sucrose metabolism
    AARI_14490 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    AARI_14490 (galU)
Enzymes [BR:aai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AARI_14490 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1650104..1651003
Genome map
AA seq 299 aa AA seqDB search
MPKSAITKAVIPAAGLGTRFLPATKAMPKEMLPVVDKPAIQYVVAEAVKSGFTDLLMVTG
RNKRALEDHFDRVPSLEYSLEAKGDKKKLDAIHEATRLGDIHYVRQGDPRGLGHAVLCAK
QHVGNEPFAVLLGDDLIDERDELLSVMAEVQRKTGGSVIALMEVEPEQISAYGCADVSLV
ESEDFVKVNALVEKPEINEAPSNLAIIGRYLLHPRVFEVLEHTAPGRGNEIQLTDALQIL
AAAHGEGAGVHAVIFRGRRYDTGDKLSYLQANITLAVENDELGPSLKSWLKGFVNQLAD
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagtcggctattactaaggcagtgattccagcggcaggcttgggcactcgattc
ctacctgcaacgaaggcaatgcctaaagagatgttgccggttgtcgataagccagccatt
caatacgtagtcgcagaagccgttaagtccggtttcactgacttgctgatggttactggt
cgtaataaacgtgctcttgaagatcacttcgatcgtgttccgtcgctcgaatactcgtta
gaagcgaagggcgacaagaagaagcttgacgcgattcatgaggccactcgcctaggtgat
atccactatgtacgccagggcgatccacgcggcctaggacatgctgtcctgtgtgccaag
cagcatgtaggcaacgaaccgttcgctgttctattaggcgatgacttgattgacgagcgt
gacgagctgctgtccgtcatggccgaggttcaacggaaaactggtggttccgtcattgcg
ctgatggaagtggagccggaacaaatcagtgcgtacggatgtgccgatgtctccctggtg
gaaagcgaagactttgttaaagtcaacgctctcgtcgaaaagcccgagatcaacgaggca
ccaagcaacctggcaattattggtaggtaccttcttcatccacgtgtgtttgaagtcttg
gagcacacggcacccggtcgtggaaacgaaatccagcttacagatgcgttgcagatactc
gctgcggcacatggcgaaggcgccggagtgcatgcagtcattttccgtggacgccgttat
gatactggcgacaagctcagctatctgcaggcaaatattacattggccgttgagaacgat
gaactgggaccaagtctaaaatcgtggctcaaaggatttgtcaatcagctagcggactag

DBGET integrated database retrieval system