KEGG   Arthrobacter arilaitensis: AARI_14920Help
Entry
AARI_14920        CDS       T01320                                 

Definition
fatty-acid--Co-A ligase (EC:6.2.1.-)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aai  Arthrobacter arilaitensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AARI_14920
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AARI_14920
   00620 Pyruvate metabolism
    AARI_14920
   00640 Propanoate metabolism
    AARI_14920
  Energy metabolism
   00680 Methane metabolism
    AARI_14920
Enzymes [BR:aai01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AARI_14920
Lipid biosynthesis proteins [BR:aai01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AARI_14920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1720034..1721746)
Genome map
AA seq 570 aa AA seqDB search
MSNTDKFRAARDLLLAARDDYDRARAEFTWPEFTDFNFAYDWFDAVAKDPKRADQPALIL
TEPDGSTARYSWAQLSHRSTQVARWLSDEGLQRGDTIILMLGNEVALWELMLAGMKLAAV
IIPSTTQLVSADLADRIERGNANWVITSHEHVAKFDTVPGDYRIVQVRGEATEHTLDYAK
SFDAPAEFSLQSPTLADENMLLYFTSGTTSLAKLVQHTHTSYTIGHLATMFWIGLEPGDV
HLNVASPGWGKHAWSNFFGPWIAEATVFVYNYDRFDPLALMNQMDTENVTSFCAPPTVWR
YLIQADLSALKTPPRKLVSAGEPLNAEVIDQVRTAWGQVIRDGYGQTETTVQIANSPGTE
VKVGAMGRPMPGYVVELRNPTTGELAEVGEICLRLDPKPAGLMKGYFADPQKTEEALRGG
VYHTGDIAERDEEGVLTYVGRADDVFKSSDYKLSPFELESVVLEHPAVAEVAVVPSPDPL
KLSVPKAFVVLAANVEPSAAVAKDILGFCREQLAPYKRIRRLEFSQLPKTISGKIRRVEL
RLAEEEQQAKGAKPSGEYRDTDFPELKSLG
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgagcaataccgataagttccgggccgcacgcgatctgctgctggcagcacgcgatgac
tacgaccgggcacgggcagagttcacttggccggaattcaccgatttcaacttcgcctat
gactggtttgatgccgtagccaaggacccaaagcgggctgatcagccagcattgatcctc
accgaaccagatggcagtacagctcgctacagctgggcgcagctctcgcaccgttctacc
caagtggcccgctggctttccgacgaaggactgcaacgcggggacacgatcatcctgatg
ctcggcaacgaggtggccctgtgggaattgatgctcgcgggcatgaagctggcagcggtg
atcatcccttccaccacccagctggtcagcgcagaccttgccgaccgcattgagcgcggc
aacgcgaactgggtgatcaccagccatgaacacgtcgccaaattcgacaccgtgccagga
gactaccggattgtccaggtacgcggcgaggcaaccgagcacaccttggactacgccaag
tccttcgatgcgccagctgaattcagccttcagagcccaacgctggccgatgaaaacatg
ctgctctacttcacctcgggcaccacgtcgttggcaaaactggtccagcacacccacacc
tcgtacaccatcggccacctggcaaccatgttctggatcggcttggagcccggagatgtt
catttgaacgtcgcttcccccggctggggcaagcacgcatggtccaatttcttcggtccg
tggatcgctgaagccaccgttttcgtttacaactatgatcgctttgatccgctggccctg
atgaatcagatggacaccgagaacgtcaccagcttctgcgcaccgcctacggtttggcgc
tacctgatccaggcagacctgagcgcactgaagactcccccgcgcaagctggtctcggcc
ggagagccgttgaatgccgaggtcattgaccaggtgcgcacggcgtggggccaggtgatt
cgcgatggctacggccagaccgagactacggtgcagatcgccaactccccgggcaccgag
gtgaaagtcggtgcaatgggccgcccgatgccaggctatgtggtggagctgcgcaatccg
accaccggagaactggctgaagtcggcgagatctgcttgcgattggatcccaagcctgcc
ggcttgatgaaaggctactttgccgatccgcagaagaccgaggaagccctgaggggcggg
gtctaccacactggcgatattgccgagcgcgatgaagaaggcgtcttgacctatgtgggc
cgagccgatgacgtcttcaaatccagcgattacaagctcagccccttcgagctggaatcg
gtcgtgctggagcatccagcggttgccgaagtagcggtggttccatcaccggatccgctc
aagctctcggtacccaaggcatttgtggtgctggccgcgaatgtcgagccttcagcggcg
gttgccaaggacatcctcgggttctgccgtgagcagctggccccttacaaacggatccgc
cgtctcgaattttcccagctcccgaagaccatttccggcaagatccgccgtgtggaactt
cgcctggccgaggaagagcagcaggccaaaggcgccaagcccagcggcgaataccgggac
acggattttccggagttgaagagtctgggctag

DBGET integrated database retrieval system