KEGG   Glutamicibacter arilaitensis Re117: AARI_14920Help
Entry
AARI_14920        CDS       T01320                                 

Definition
(GenBank) putative fatty-acid--Co-A ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aai  Glutamicibacter arilaitensis Re117
Pathway
aai00010  Glycolysis / Gluconeogenesis
aai00620  Pyruvate metabolism
aai00640  Propanoate metabolism
aai00680  Methane metabolism
aai01100  Metabolic pathways
aai01110  Biosynthesis of secondary metabolites
aai01120  Microbial metabolism in diverse environments
aai01130  Biosynthesis of antibiotics
aai01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AARI_14920
   00620 Pyruvate metabolism
    AARI_14920
   00640 Propanoate metabolism
    AARI_14920
  Energy metabolism
   00680 Methane metabolism
    AARI_14920
Enzymes [BR:aai01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AARI_14920
Lipid biosynthesis proteins [BR:aai01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AARI_14920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CBT75716
UniProt: E1VVR3
Position
complement(1720034..1721746)
Genome map
AA seq 570 aa AA seqDB search
MSNTDKFRAARDLLLAARDDYDRARAEFTWPEFTDFNFAYDWFDAVAKDPKRADQPALIL
TEPDGSTARYSWAQLSHRSTQVARWLSDEGLQRGDTIILMLGNEVALWELMLAGMKLAAV
IIPSTTQLVSADLADRIERGNANWVITSHEHVAKFDTVPGDYRIVQVRGEATEHTLDYAK
SFDAPAEFSLQSPTLADENMLLYFTSGTTSLAKLVQHTHTSYTIGHLATMFWIGLEPGDV
HLNVASPGWGKHAWSNFFGPWIAEATVFVYNYDRFDPLALMNQMDTENVTSFCAPPTVWR
YLIQADLSALKTPPRKLVSAGEPLNAEVIDQVRTAWGQVIRDGYGQTETTVQIANSPGTE
VKVGAMGRPMPGYVVELRNPTTGELAEVGEICLRLDPKPAGLMKGYFADPQKTEEALRGG
VYHTGDIAERDEEGVLTYVGRADDVFKSSDYKLSPFELESVVLEHPAVAEVAVVPSPDPL
KLSVPKAFVVLAANVEPSAAVAKDILGFCREQLAPYKRIRRLEFSQLPKTISGKIRRVEL
RLAEEEQQAKGAKPSGEYRDTDFPELKSLG
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgagcaataccgataagttccgggccgcacgcgatctgctgctggcagcacgcgatgac
tacgaccgggcacgggcagagttcacttggccggaattcaccgatttcaacttcgcctat
gactggtttgatgccgtagccaaggacccaaagcgggctgatcagccagcattgatcctc
accgaaccagatggcagtacagctcgctacagctgggcgcagctctcgcaccgttctacc
caagtggcccgctggctttccgacgaaggactgcaacgcggggacacgatcatcctgatg
ctcggcaacgaggtggccctgtgggaattgatgctcgcgggcatgaagctggcagcggtg
atcatcccttccaccacccagctggtcagcgcagaccttgccgaccgcattgagcgcggc
aacgcgaactgggtgatcaccagccatgaacacgtcgccaaattcgacaccgtgccagga
gactaccggattgtccaggtacgcggcgaggcaaccgagcacaccttggactacgccaag
tccttcgatgcgccagctgaattcagccttcagagcccaacgctggccgatgaaaacatg
ctgctctacttcacctcgggcaccacgtcgttggcaaaactggtccagcacacccacacc
tcgtacaccatcggccacctggcaaccatgttctggatcggcttggagcccggagatgtt
catttgaacgtcgcttcccccggctggggcaagcacgcatggtccaatttcttcggtccg
tggatcgctgaagccaccgttttcgtttacaactatgatcgctttgatccgctggccctg
atgaatcagatggacaccgagaacgtcaccagcttctgcgcaccgcctacggtttggcgc
tacctgatccaggcagacctgagcgcactgaagactcccccgcgcaagctggtctcggcc
ggagagccgttgaatgccgaggtcattgaccaggtgcgcacggcgtggggccaggtgatt
cgcgatggctacggccagaccgagactacggtgcagatcgccaactccccgggcaccgag
gtgaaagtcggtgcaatgggccgcccgatgccaggctatgtggtggagctgcgcaatccg
accaccggagaactggctgaagtcggcgagatctgcttgcgattggatcccaagcctgcc
ggcttgatgaaaggctactttgccgatccgcagaagaccgaggaagccctgaggggcggg
gtctaccacactggcgatattgccgagcgcgatgaagaaggcgtcttgacctatgtgggc
cgagccgatgacgtcttcaaatccagcgattacaagctcagccccttcgagctggaatcg
gtcgtgctggagcatccagcggttgccgaagtagcggtggttccatcaccggatccgctc
aagctctcggtacccaaggcatttgtggtgctggccgcgaatgtcgagccttcagcggcg
gttgccaaggacatcctcgggttctgccgtgagcagctggccccttacaaacggatccgc
cgtctcgaattttcccagctcccgaagaccatttccggcaagatccgccgtgtggaactt
cgcctggccgaggaagagcagcaggccaaaggcgccaagcccagcggcgaataccgggac
acggattttccggagttgaagagtctgggctag

DBGET integrated database retrieval system