KEGG   Arthrobacter arilaitensis: AARI_17160Help
Entry
AARI_17160        CDS       T01320                                 

Gene name
pyrC
Definition
dihydroorotase (EC:3.5.2.3)
Orthology
K01465  
dihydroorotase [EC:3.5.2.3]
Organism
aai  Arthrobacter arilaitensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AARI_17160 (pyrC)
Enzymes [BR:aai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.3  dihydroorotase
     AARI_17160 (pyrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1952966..1954270)
Genome map
AA seq 434 aa AA seqDB search
MNYLIQQVSILGGEPTDVLIVDGKIAQIGSIEATDQHQMIDAKNLVLLPGLVDTHTHLRE
PGREDAETVETGSQAAALGGYTAVHAMANSTPVADTAGVVEQVFELGRAAGWVDVRPVGA
VTVGLAGKQLSEIGAMADSRAQVKMFSDDGICVWDPLLMRRALEYVKAFDGVIAQHAQEP
RLTEGAQMNEGEVSSILGMPGWPAVAEESIIARDVLLAEHVGARLHVCHVSTAGSVEIIR
WAKARGIQVTAEVTPHHLLLTDEKVRTYDPVFKVNPPLRREEDVMALRDGVADGTIDVIG
TDHAPHPSEAKDCEWGAAAMGMTGLETALSIVQHTLVETGLLGWDAVARITSEVPAQIGR
VADQGRPIAVGEPANLTLVDPAARWIVDPSAMATKGRNSPFAGMELPGSVRATFFHGHAT
VLDGKLGTPRAANA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaactacttaatccagcaggtatccatcctcggcggcgaaccaaccgacgtgctcatc
gtcgacggcaagatcgcgcagatcggcagcattgaagccaccgaccagcaccagatgatt
gacgcgaagaatctcgtgctcttgcccgggctggtcgacacccacacccacctgcgcgaa
ccaggccgcgaagatgctgaaaccgtggaaaccggttcgcaggcagcagccctgggcggc
tacaccgccgtgcatgccatggcaaactcgaccccggtagccgacaccgccggcgtcgtc
gagcaagtcttcgaactgggccgcgctgcaggctgggtggatgtccgcccggttggcgca
gtcaccgtcggactggccggcaagcagctgagtgaaatcggcgccatggccgactcgcgc
gcccaggtgaagatgttctccgatgacggcatctgcgtctgggatccgctgctgatgcgc
cgcgccctggaatacgtgaaagctttcgacggagtcatcgcccagcacgcacaagaaccg
cgcctgaccgaaggcgcccagatgaacgagggcgaagtctcctcgatcctgggcatgcca
ggctggccagcggtggccgaagagtcgatcatcgcccgcgacgtgctgctggccgagcac
gtcggtgcccgcctgcacgtctgccacgtgtccaccgccggttcggtagagatcatccgc
tgggccaaggcccgcggcatccaggtcaccgccgaagtcaccccgcaccacctgctgctc
accgacgaaaaggtgcgcacctacgacccggtattcaaggtcaacccgccgctgcgccgc
gaagaagatgtcatggcgttgcgcgacggcgtcgccgatggcaccatcgacgtgatcggc
accgaccacgcgccgcacccttccgaagccaaggactgcgaatggggcgctgccgccatg
ggcatgaccggtctggaaaccgcactgtccatcgtgcagcacaccctggtggaaaccggt
ctgctgggctgggacgcggttgcgcggatcacctcggaagttccggcgcagatcggccgc
gtagccgaccagggccgcccgatcgctgtgggcgaaccggccaacctgaccctcgtggac
ccggcagcacgctggatcgtggatccatcggccatggccaccaagggccgcaactcgccg
ttcgccggcatggagctgccaggttcggtgcgcgccaccttcttccacggccacgccacc
gtactggatggcaagctgggaaccccgagggcagccaatgcctga

DBGET integrated database retrieval system