KEGG   Arthrobacter arilaitensis: AARI_17280Help
Entry
AARI_17280        CDS       T01320                                 

Definition
aminodeoxychorismate lyase (EC:4.1.3.38)
Orthology
K07082  
UPF0755 protein
Organism
aai  Arthrobacter arilaitensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1962177..1963622)
Genome map
AA seq 481 aa AA seqDB search
MREEARHDRQRETHRALYERFAAGTGFQIEQPSEPEVTGSEDFTQTLAASTDPAHAPVAA
DGEGTDTGFLPAQPDAPTLDEPGHHEPEPEYPAEHDAADEQYAQAAPAGLLGQEADAQNL
DPHKTKRCKRTKRRRNLVMLATVLIFALVVTGSAYFLKSVLKQFNPDDYPGPGGAAVEFT
VEDGWGVNIISRKLEELDVVASDKLFSDAVSDSDSENKLIHPGTYLLKKQMPAAEAASAL
IDQRPDKVFYIGLKANMRLEAAIAEIAKGSGLKEKELTALANKPEKFDLPGSVPNLEGWL
HPGEYRFKLNTSAEEVLSTLVKSTKASLEQFSITDLDEGYRILKVASILQAEARTPDYAT
VAGAIENRLNPNNKETHGLLQVDSSVIYGLGRYSLQFSPEEKADASNKYNTYEHAGLPPT
PLGSPANAAIEAAAHPEDNGYYYWVTVNIETGETKFASNYQEHLRNQAEFRAWCDQNPDV
C
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaagaagcccgccatgatcggcaacgcgaaacgcatcgcgcgctatatgaacgc
tttgccgccggcactggctttcaaatcgaacaaccctctgaaccggaagtgaccggcagc
gaagacttcactcaaactcttgctgcctccacggacccggcacacgcaccggtagctgcg
gacggggaaggaaccgataccggattcctccccgcccagcccgatgccccaaccctggac
gagcccggccaccacgagccggaacccgagtacccagcggagcacgacgccgccgatgag
caatacgcgcaggccgcacccgctggcctgctgggccaggaagctgatgcgcagaacctc
gatccgcacaagaccaagcggtgcaagcgcaccaagcgcaggcgcaacctggtcatgctg
gccaccgtgcttatcttcgcgttggtcgtcaccggctcggcgtacttcctcaaatcagta
ctcaagcagttcaaccccgatgactacccgggtccaggcggagctgccgtggaattcacg
gtggaagacggctggggcgtgaatatcatttcgcgcaagctcgaagagctggacgtggtc
gccagcgacaagctgttctccgatgccgtatcagactcggactccgaaaataagctgatc
cacccgggcacctacctgctcaagaagcagatgccagcggccgaggccgcctcggctctc
atcgaccagcgtccggacaaggtcttctacatcgggctgaaagccaatatgcgccttgaa
gccgcgatcgccgagatcgccaagggctccgggctcaaggagaaagaactgaccgcactg
gccaacaagccggaaaagttcgacctgcctggctccgtacccaaccttgaaggctggctg
cacccaggggagtaccgcttcaagctgaacaccagcgccgaagaggtcctttccacactg
gtcaagtccaccaaggcatccttggaacagttcagcatcaccgacctggacgagggctac
cggatcttgaaggtcgcctcgatcctgcaggccgaggcgcggaccccggactacgccacg
gtggccggcgcgatcgaaaaccggttgaaccccaataacaaggaaacccacggcctgctg
caggtcgattcctcggtaatctacggtctggggcgctactcgctgcagttcagccccgaa
gagaaggccgacgcgtccaataagtacaacacctacgagcatgcaggactgccaccgacc
ccattgggttcgccggcaaacgcagccatcgaagccgcagcgcatcccgaagacaacggc
tactactactgggtgacggttaatatcgaaaccggtgaaacgaagttcgcttcgaactac
caggagcatctgcgcaaccaggccgaattccgtgcctggtgcgaccagaacccggatgtc
tgctag

DBGET integrated database retrieval system