KEGG   Arthrobacter arilaitensis: AARI_18950Help
Entry
AARI_18950        CDS       T01320                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
aai  Arthrobacter arilaitensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AARI_18950 (glgB)
Enzymes [BR:aai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     AARI_18950 (glgB)
Exosome [BR:aai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AARI_18950 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2156218..2158410
Genome map
AA seq 730 aa AA seqDB search
MPDEDTSHPVLDARQVRLLSQGRHPDPFSVLGPTEDGRHLVARIPGAIQLWAVNATDEVQ
LEPHPEDPELFTGPALPYYRLRIRWASGFFEAREDPYRFGPVIGEFDEHLIGEGEHRSLW
KALGAHLITHEQVAGAHFALWAPNARRVSVVGDFNSWNGTAHPMRARGATGVWELFLPDL
DEGAVYKYEILGPDGELLPLKADPVGFGSEHPPATGSVIRRIEAHDWRDGSWLARREQIN
SVNAPISIYEVHLGSWRRTGGTGQSLSYLQLATQLVDYAADMGFTHIEVLPVTEHPFDGS
WGYQPIGLFAPTIRYGTPQEFAAFVDAAHERGLGVIADWVPGHFPTDQHGLGRFDGTALY
EHLDPREGFHPDWNTLIYNYGRPEVRNYLVANALYWLGEYHLDGLRVDAVASMINRDYSR
AEGEWIANKDGGNENYEALDFLKQTNVASYAQHPGIAMIAEDSTAYPGVTRPVDAGGLGF
GYKWNLGWMNDSLEYFGKDPVYRKHHHNQLTFGITYAFSENFLLPISHDEVVHGKGSMYS
RMPGSHADKLGNLKAFYGYMWGHPGKKLLFMGQEFGQPAEWDYQGQLDWNILDDPGHAGV
QTLVQDLNRIYREQPALHRGDARPEGFQWLLVDDIEHQVFAWLRRGEPGDPHVVVVLNLT
PVERTGFRIGFPVAGRWVEALNTDSERYHGANRGHGGAIETEAVPSGGEAQSALLTLPPL
SAIYFVEERS
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
gtgccagacgaggatacaagccatccggtgctagatgcgcggcaggtgcgcctgctgtcc
caggggcggcatccggatcctttctccgtgctcggacccaccgaagacgggcggcatctg
gtggcgcgcattccaggcgcaattcagctctgggcagtgaacgccaccgacgaggtgcag
cttgaacctcatcccgaggaccctgagcttttcaccggccccgccctgccctactacagg
ttgcgcatccgctgggcctcgggatttttcgaggcacgcgaggatccctaccgcttcggg
ccggtcatcggagaattcgacgagcacctgatcggcgaaggcgaacaccgcagcctttgg
aaagcgctgggtgcgcacctgatcacccacgagcaggttgctggcgcgcatttcgcgctg
tgggcgcccaatgctcggcgggtcagcgtagttggggatttcaactcgtggaatggcacc
gcccaccccatgcgtgcgcgcggcgccaccggagtttgggaactgttcctgcccgatctc
gatgagggcgcggtatacaagtacgaaatcctggggcccgacggcgagctgctgccgttg
aaggccgatcccgtcgggttcggttccgaacacccgccggccaccggttcggtgatccgg
cgcatcgaggcccatgattggcgtgatggatcatggctcgcccgccgcgagcagatcaac
tcggtcaatgccccgatcagcatctacgaggtgcatctgggttcttggcggcgcaccggc
ggcaccggccaatcgctgagctatctgcagctggccacgcagctcgtggactacgcggcc
gacatggggttcacccacatcgaggtcctgcctgtcaccgagcatcccttcgacggatcc
tggggctaccagcccatcgggcttttcgctccgacgatccgctacgggactccgcaggaa
tttgcggcctttgtcgacgccgcccacgaacgcgggctgggggtcattgccgactgggtt
ccggggcacttccccaccgaccagcatggcttgggccggttcgacggcactgcgctctac
gagcatcttgatccgcgtgagggcttccacccggactggaacacgttgatctacaactac
ggccgccccgaggtgcgcaactatctggtggccaatgcactgtattggctgggcgaatac
cacctcgatgggctgcgcgtggatgctgtcgcctcgatgatcaaccgcgactactcgcgc
gccgagggcgaatggatcgccaataaggacggcgggaatgaaaactacgaggccctggac
ttcctgaagcagaccaatgtggccagctatgcgcagcacccgggcatcgcgatgattgcc
gaagactccaccgcctaccccggagtcacccgcccggtggatgccggcggcctgggcttt
ggctacaagtggaacctcgggtggatgaatgactcgctggagtacttcggcaaggatccg
gtctaccgaaagcaccaccacaaccagctgaccttcggcatcacctatgccttcagcgag
aacttcctgctgccgatcagccatgacgaggtcgtgcatggcaagggctcgatgtactcg
cgcatgccaggcagccacgccgacaagctcggcaacctcaaggccttctacggctacatg
tgggggcatccgggcaagaagctgctgttcatgggccaagaattcggccagcccgccgaa
tgggactaccagggccagctcgactggaacatcctcgatgaccctggccacgccggcgtg
cagaccctggtccaggatctcaaccggatctaccgcgagcaaccggccctgcatcggggc
gatgcccgcccggaggggttccaatggctgctggtcgacgacatcgagcatcaggtcttc
gcttggctgcgccgcggcgaacctggcgacccccacgtggtcgtcgttctgaacctcacc
ccggtggaacgcaccggattccgcattggattcccggtggccggacgctgggtcgaggcc
ctgaataccgattccgaacgctaccacggggccaatcgcggtcacggtggagccatcgaa
accgaagccgtcccctcaggcggcgaagcacaatccgcactgctcacgctcccaccctta
tcggcaatctattttgtggaggaacgctcatga

DBGET integrated database retrieval system