KEGG   Arthrobacter arilaitensis: AARI_19010Help
Entry
AARI_19010        CDS       T01320                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aai  Arthrobacter arilaitensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AARI_19010 (tpiA)
   01230 Biosynthesis of amino acids
    AARI_19010 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AARI_19010 (tpiA)
   00051 Fructose and mannose metabolism
    AARI_19010 (tpiA)
   00562 Inositol phosphate metabolism
    AARI_19010 (tpiA)
Enzymes [BR:aai01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AARI_19010 (tpiA)
Exosome [BR:aai04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AARI_19010 (tpiA)
  Exosomal proteins of bladder cancer cells
   AARI_19010 (tpiA)
  Exosomal proteins of melanoma cells
   AARI_19010 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2163666..2164481)
Genome map
AA seq 271 aa AA seqDB search
MTISQNGAYVRQPLIAGNWKMNMDHVQGITLVQKLAWTLKDHEHDYDRAEVAVFPPFTDI
RGVQTLTLGDKLDIVYGAQDLSAQDSGAYTGEISGQFLKKLGCSYVLVGHSERREYHNET
NQVIAAKLAAAYRHEMTPMLCVGEGLDVRKAGEHVAFTLEQLAQSLEGVSAEQAENLVIA
YEPVWAIGTGEVAGPADAQEMCAAIRGALAERFGTEIAEKTQLLYGGSVKAANAASIMRE
RDVDGVLVGGASLDAEEFANIVRFEHHLVTD
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaccatttcgcagaacggcgcctacgtgcgccagccgctgattgccggcaactggaag
atgaacatggaccacgtccagggcatcaccctggtgcagaagctggcgtggaccctgaaa
gaccacgagcatgattacgatcgtgccgaggttgcagtgttccctcccttcaccgacatc
cgtggcgtgcagaccctgaccttgggtgacaagctggatatcgtttacggtgcccaggac
ctgtccgcacaggattcaggtgcgtacaccggcgaaatttccggccagttcctcaagaag
ctcggttgcagctacgtactcgttggccactccgagcgtcgcgagtaccacaacgaaacc
aaccaggtgattgccgcgaagctggcagccgcttaccgccacgagatgaccccgatgctt
tgcgtcggagaaggcctggacgtgcgcaaggctggcgagcatgttgcattcaccttggag
cagttggcacagtcgctggaaggcgtatccgctgagcaggccgaaaacctggtcatcgct
tacgaaccagtgtgggccatcggcaccggtgaagttgcaggaccagctgacgcccaggaa
atgtgcgccgccattcgcggtgcgcttgctgaacgcttcggtacggagattgctgagaag
acccaactgctctatggcggtagtgttaaggcagcaaacgccgcatcgatcatgcgtgaa
cgcgatgttgatggcgtgttggttggcggtgccagcctagacgctgaagaatttgctaat
attgtcaggttcgagcatcatctcgtcaccgactga

DBGET integrated database retrieval system