KEGG   Arthrobacter arilaitensis: AARI_19030Help
Entry
AARI_19030        CDS       T01320                                 

Gene name
gap
Definition
glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.12)
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
aai  Arthrobacter arilaitensis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
D-galactonate degradation, De Ley-Doudoroff pathway, D-galactonate => glycerate-3P
Class
Metabolism; Overview; Carbon metabolism [PATH:aai01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:aai01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aai00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2165731..2166738)
Genome map
AA seq 335 aa AA seqDB search
MTTRVGINGFGRIGRNFLRAVLAHKADIEIVAVNDLGSIDSLAHLVKFDSVLGPVGESVS
VDGDTIVVGERRIKVLSEREPANLPWGELNVDVVIESTGFFTNAEDAKKHVAAGAKKVII
SAPAKNEDITIVMGVNQDKYDPANHAIISNASCTTNCLAPVAKVLNEEFGIVDGLMTTIH
AYTADQRLQDAPHSDPRRARAAALNVIPTSTGAAKAIGVVLPELKGKLHGYAMRVPVPTG
SATDLTVNLARTATVEEINAAFEKAAAEGSLSEYLEYSTDPLVSSDIVTNPHSAVFDSGL
TTVMGNSVKVVAWYDNEWGYSSRLVDLVEFVGSSL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgacaacccgtgttggaatcaatggtttcggtcgtatcggacgcaacttcttgcgtgca
gttctggcccacaaggcagacattgaaatcgtcgccgtcaatgaccttggttcaatcgat
tcgcttgctcacctggtgaagtttgattccgttctcggcccagtgggcgagtcggtatcc
gtagatggcgataccatcgtcgtcggagaacgccgtatcaaggttctgtctgagcgcgag
ccagccaaccttccatggggcgagttgaacgtcgatgtcgttatcgagtcgaccggattc
ttcaccaacgcagaagacgccaagaagcacgttgctgctggcgccaagaaggtcatcatc
tcggctccggccaagaacgaagacatcaccatcgtgatgggtgtcaaccaggacaagtac
gatcctgcaaaccacgccattatttcgaacgcatcatgcaccaccaactgcctggctcca
gtagccaaggtgctgaacgaagagttcggcattgttgatggcctgatgaccaccatccac
gcttacaccgcagaccagcgcctgcaggacgcaccgcacagcgacccacgccgtgcccgc
gccgcagcactgaacgtcatcccgacctccaccggtgccgccaaggccatcggcgtggtg
ctcccagagctcaaaggtaagctgcacggttacgctatgcgcgtaccagttccaaccggt
tcggccactgacctgaccgtcaacctggctcgcaccgcaaccgtggaagaaatcaacgca
gcattcgagaaggcagctgctgaaggttccttgagcgaataccttgagtactcgaccgat
ccactggtctcttcggacatcgtgaccaacccgcactcggcagttttcgactccggtctg
accaccgtgatgggcaacagcgtcaaggtcgtcgcgtggtacgacaacgagtggggctac
tcctcgcgacttgttgacctcgttgaattcgtgggatccagcctctag

DBGET integrated database retrieval system