KEGG   Glutamicibacter arilaitensis Re117: AARI_19450Help
Entry
AARI_19450        CDS       T01320                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aai  Glutamicibacter arilaitensis Re117
Pathway
aai00260  Glycine, serine and threonine metabolism
aai00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aai01100  Metabolic pathways
aai01110  Biosynthesis of secondary metabolites
aai01130  Biosynthesis of antibiotics
aai01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AARI_19450 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AARI_19450 (trpA)
Enzymes [BR:aai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AARI_19450 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA PcrB
Motif
Other DBs
NCBI-ProteinID: CBT76164
UniProt: E1VX11
Position
complement(2217521..2218303)
Genome map
AA seq 260 aa AA seqDB search
MTRVTSAEKIAAARAEGRPALIGYLPAGFPDVQTSIDAAVALAENGVDVIEIGIPYSDPV
MDGAVIQEATVQALANGFKVPQIFEIVRGITERTNAAVMVMTYWNPVLRLGVDEFSRRFA
EAGGAGLITPDLVPDEADEWLAASEKYGLERVFLIAPSSTEDRVQRTVDASSGFVYCVSL
MGVTGARTEVSSAAQAVVDAAHNAGAENACVGLGVSRREHVEEIGAYADGVIVGTALVAA
LRDGGVKAVGALAAELSGRA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgtgaccagcgccgagaagatcgccgcagcccgcgccgagggccgtccggcc
ctgatcggctacctgccggccggcttccccgacgtccaaaccagcattgacgccgccgtg
gccctggccgaaaacggggtggatgtcatcgagatcggcattccgtactccgacccggtc
atggacggcgcagtcatccaggaagccaccgtgcaggcactggccaacggcttcaaggtt
ccgcagatcttcgagatcgtgcgcggcattaccgaacgcactaacgccgcagtgatggtc
atgacctactggaacccggtactgcgcctgggcgtggacgagttctcccgccgcttcgct
gaagccggcggcgccgggctaatcaccccggacctggtcccggatgaagccgacgaatgg
ctggcagccagcgaaaagtacggcctggaacgcgtcttcctgatcgcgccatcctcgacc
gaagaccgcgtccagcgcaccgtggacgcttcttccggattcgtctactgcgtgtcgctg
atgggcgtgaccggtgcccgcaccgaggtatcttccgccgcccaggccgtggtggatgca
gcgcacaacgccggcgccgaaaacgcctgcgtaggcttgggtgtttcgcgccgcgagcac
gtcgaggaaatcggcgcctacgctgacggagtgatcgtgggcaccgcactggtggccgcc
ctgcgtgacgggggagtgaaggcagtgggcgcactggccgctgaactgagcggacgcgcc
tga

DBGET integrated database retrieval system