KEGG   Glutamicibacter arilaitensis Re117: AARI_19460Help
Entry
AARI_19460        CDS       T01320                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aai  Glutamicibacter arilaitensis Re117
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AARI_19460 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AARI_19460 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AARI_19460 (trpB)
Enzymes [BR:aai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AARI_19460 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2218304..2219635)
Genome map
AA seq 443 aa AA seqDB search
MSTSDNSETGQSIDAQSLRHASGPYFGAYGGRWMPESLMAAMDELNETFEAAKNDPEFIA
QVKDLNKNYSGRPSLLTEAKRFSEQYCGGVRIFLKREDLNHTGSHKINNVLGQALLAKRM
GKTRIIAETGAGQHGVASATAAALMGLECVVYMGAEDTRRQALNVARMRLLGATVIPVTV
GSQTLKDAINEALRDWVANVDNTHYLLGTAAGGAPFPAMVRYFHEVIGDEAREQILAQAG
RLPDAVTACIGGGSNAIGIFHGFLDDKDVEIYGFEAGGDGVDTDRHAATITLGRPGVLHG
AKSYLMQDEDGQTVESHSISAGLDYPGVGPEHAYLADIGRVAYEPVTDTEAMDAFKALCR
TEGILPAIESAHALAGTIRIAQRKIAEGAVPEETIIIANLSGRGDKDVGTAAAWFNMIDE
KDAEAEIAAATAQHSGSQNSKEK
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgagcacttcggacaattccgagaccggccagtcgatcgatgcacagtcgttgaggcac
gcaagcggcccgtactttggtgcctacggtggacgatggatgcccgaatccctcatggcc
gccatggacgagctgaacgagaccttcgaagcggccaagaacgatcccgagttcatcgcc
caggtcaaggacctgaacaagaactactcgggccgtccctccctgctcaccgaagccaag
cgcttctccgagcagtactgcggcggggtgcgcatcttcctcaagcgcgaagatctgaac
cacaccggcagccacaagatcaacaacgtgctcggccaggcattgctggccaagcgcatg
ggcaagacccgcatcatcgccgaaaccggagcgggccagcacggcgtcgcctcggctacc
gccgcggccctgatgggcttggagtgcgtggtctacatgggcgccgaagacactcgccgc
caggcgctgaacgttgcccggatgcgcctgctcggcgccaccgtcatcccggtgaccgtt
ggctcgcagacgctgaaggacgcgatcaacgaagccttgcgcgactgggtcgcgaacgtg
gacaacacccactacctgctgggcaccgccgccggcggcgcaccattcccagccatggtc
cgctacttccacgaggtcatcggcgacgaggcccgcgagcagatcctggcccaggccggc
cgcctgccagacgcggtcaccgcctgcatcggcggcggctcgaacgccatcggcatcttc
cacggcttcctggatgacaaggacgtggaaatttacggcttcgaagctggcggcgacggc
gtagacaccgaccgccacgccgcaaccatcaccctgggccgcccgggcgtgctgcacggc
gcgaagtcctacctgatgcaggacgaagacggccagactgtcgaatcgcactccatctcc
gcaggcctggactacccgggcgtcggcccggagcacgcctacctggcagacatcggccgc
gtagcctacgaaccggtcaccgacaccgaagccatggacgccttcaaggcgctatgccgc
accgagggcatcctgccggcgatcgaatccgcgcacgccctggcaggcaccatccgcatt
gcccagcgcaagatcgccgaaggcgccgtgcccgaagagaccatcatcatcgcgaacctc
tcgggccgcggcgacaaggacgtgggcaccgcagcggcctggttcaacatgattgacgaa
aaggacgcggaagccgaaatcgccgccgcgaccgcgcagcactccggctcgcagaattcg
aaggagaagtag

DBGET integrated database retrieval system