KEGG   Glutamicibacter arilaitensis Re117: AARI_19470Help
Entry
AARI_19470        CDS       T01320                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
aai  Glutamicibacter arilaitensis Re117
Pathway
aai00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aai01100  Metabolic pathways
aai01110  Biosynthesis of secondary metabolites
aai01130  Biosynthesis of antibiotics
aai01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AARI_19470 (trpC)
Enzymes [BR:aai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     AARI_19470 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh OMPdecase QRPTase_C DUF1863 Synuclein FAA_hydrolase_N
Motif
Other DBs
NCBI-ProteinID: CBT76166
UniProt: E1VX13
Position
complement(2219744..2220568)
Genome map
AA seq 274 aa AA seqDB search
MTVLDDIIAGVREDLGARRAITSLEAIKAAAAQAAPALDAFAALGGHADQAARDTTLRVI
SEVKRKSPSKGALADIPAPAVLAAEYQAGGASVISVLTEARRFGGSLEDLDAVRAAVQIP
VLRKDFTVDEYQIYEARAHGADLVLLIVAALNDDLLASFLELTHQLGMNALVETHTEEEI
ARAVKAGAKIIGVNVRNLKTLDVDPATFGKLAPLLPAQAVIVAESGVESIDQVAQYGAAG
ADAILVGEALVKHADPRATVAAFITAGTEAKPQR
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
ttgactgttcttgatgacatcatcgcgggcgtccgggaagacctgggcgcccgtcgcgca
atcaccagcctggaagcgatcaaggcggcagcagcccaagccgccccggcactggacgca
ttcgccgctttgggcggccacgcggaccaagcagcccgcgacaccaccctgcgggtgatc
tccgaggtcaagcgcaagtccccatccaagggcgcactggctgacatcccggcgccggcg
gtgctggccgccgaataccaggccggtggcgcctcggtgatctcggtgctgaccgaagca
cgccgcttcggcggttcgctggaggatctggatgccgtgcgcgccgcggtgcagatcccg
gtgctgcgcaaggatttcaccgtcgatgagtaccagatctacgaggcccgcgcccacggt
gctgacctcgtgttgctcattgttgcggcgctaaatgatgatttgctggcatctttccta
gaattgacccaccagctgggaatgaacgccctggtggagacccacaccgaggaagaaatc
gcccgtgccgtcaaggccggggcgaagatcatcggcgtgaacgtgcgcaatctgaagacg
ctggatgtcgatccggccaccttcggcaagctcgccccgctgctgcctgcccaggcagtc
atcgtcgccgagtccggtgtggaatccatcgaccaggtcgcccaatacggtgcggccggt
gccgatgccatcctggttggcgaggcgctggtgaagcatgccgatccgcgcgctacggtc
gccgcgttcatcaccgctggtaccgaggccaaaccgcagcgctag

DBGET integrated database retrieval system