KEGG   Arthrobacter arilaitensis: AARI_20280Help
Entry
AARI_20280        CDS       T01320                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aai  Arthrobacter arilaitensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AARI_20280 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AARI_20280 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    AARI_20280 (sucB)
Enzymes [BR:aai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AARI_20280 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2309105..2310745
Genome map
AA seq 546 aa AA seqDB search
MSETVNLPALGESVTEGTVTRWLKQVGDRVEVDEPLVEVSTDKVDTEVPSPVAGIIEEIF
VAEDEDAEVGAPLVRIGDGSGSGESAPAAEEAPAAEEAPAAPAAEEAPAAPAAEEAPAAA
PADGAASGTEVTLPALGESVTEGTVTRWLKEVGEEVSVDEPLLEVSTDKVDTEVPSPVAG
TLLEIRVPEDETAEVGAVLAVIGSANAAPAKEEAPAAAPAPAKAEAPAAPAAPASEANNE
SGYVTPLVRRLANQNNIDIASVKGTGVGGRIRKQDVLDAVAAQETSAPTAAPAAAKPAAP
SVEVSSLRGTEEKAPRIRQVIARRMRESLDVSTQLTQVHEIDMTRIVKLRASAKANFKAT
NGVNLTYLPFIAKAVAEGLKAHPKLNAEYNEETQKITYHNAEHLAFAVDTDKGLLVPVVS
NAGDLNLAGMASRIADVANRTRTNKIGPDELSGGTFSITNIGSVGALFDTPIINQPQVAI
LGTGAIVKRPMVVTDAEGNDSIAIRHMMYLCLTYDHRLVDGADAGRFLQTVKARLEGGAF
EGELGL
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaccgtaaacctacccgcactgggtgaaagcgttaccgaaggtacggtaacc
cgctggctgaagcaggtcggcgaccgtgtagaggtagacgagccgttggtggaagtatcc
actgacaaggtagacactgaagttccttcgccggttgctggcatcattgaggaaatcttc
gtagcagaagacgaggacgcagaagttggcgcccctctggttcgcattggcgacggttcc
ggctccggcgagtccgcaccagctgctgaagaagcaccggctgctgaagaggcacctgct
gctccggctgctgaggaagctcctgctgctccagctgctgaagaagctcctgctgccgca
ccggctgacggcgctgcatcgggcaccgaagttacccttccagctctgggcgagtcggtt
accgaaggtaccgtcacccgttggttgaaggaagttggcgaagaagtttccgtcgacgag
ccactgcttgaggtttcgaccgacaaggttgacaccgaagttccttccccagttgctggt
accttgctggaaatccgcgttccagaagacgagaccgctgaagttggcgccgttcttgct
gtaatcggttccgctaacgcagcgccagccaaggaagaagcaccagctgctgctccagct
ccagctaaggcagaagctcctgccgctccagccgctccagcctctgaagcgaacaacgag
tccggctacgtcaccccactggtacgccgcttggctaaccagaacaacatcgatatcgct
tcggtgaagggtaccggcgttggcggtcgcatccgcaagcaggatgttctggacgctgta
gctgctcaggaaacttctgcgccgactgctgctcctgctgctgccaagccagctgctcct
tccgttgaggtttcctcgctgcgcggcaccgaggaaaaggctccacgtatccgccaggtt
atcgctcgccgcatgcgcgagtcgctggacgtttcgactcagctgacccaggtccacgag
atcgatatgacccgtatcgtgaagctgcgcgcttcggccaaggccaacttcaaggccacc
aacggtgtgaacctgacatacctgccattcatcgccaaggctgttgccgaaggcctgaag
gcacaccctaagttgaacgctgagtacaacgaagagacccagaagatcacttaccacaat
gccgagcacctggcatttgcagtcgataccgacaagggcctgctggttcctgttgtatcg
aacgctggcgatctgaacctggctggcatggcttcgcgcattgctgacgtggcaaaccgc
acccgtaccaacaaaattggtccagacgagctgtccggtggcaccttctcgatcaccaac
atcggttcggttggcgcactgttcgataccccgatcatcaaccagccacaggtcgcaatt
ctgggcaccggtgcgatcgtgaagcgtccaatggtcgttaccgatgcagagggcaatgat
tcgattgccatccgccacatgatgtacctgtgcctgacctacgatcaccgtctggttgat
ggcgccgatgcaggtcgcttcctgcagaccgtcaaggctcgccttgagggtggcgctttc
gaaggcgaactgggactgtaa

DBGET integrated database retrieval system