KEGG   Glutamicibacter arilaitensis Re117: AARI_20280Help
Entry
AARI_20280        CDS       T01320                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aai  Glutamicibacter arilaitensis Re117
Pathway
aai00020  Citrate cycle (TCA cycle)
aai00310  Lysine degradation
aai01100  Metabolic pathways
aai01110  Biosynthesis of secondary metabolites
aai01120  Microbial metabolism in diverse environments
aai01130  Biosynthesis of antibiotics
aai01200  Carbon metabolism
Module
aai_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aai_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AARI_20280 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    AARI_20280 (sucB)
Enzymes [BR:aai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AARI_20280 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H BASP1
Motif
Other DBs
NCBI-ProteinID: CBT76247
UniProt: E1VX94
Position
2309105..2310745
Genome map
AA seq 546 aa AA seqDB search
MSETVNLPALGESVTEGTVTRWLKQVGDRVEVDEPLVEVSTDKVDTEVPSPVAGIIEEIF
VAEDEDAEVGAPLVRIGDGSGSGESAPAAEEAPAAEEAPAAPAAEEAPAAPAAEEAPAAA
PADGAASGTEVTLPALGESVTEGTVTRWLKEVGEEVSVDEPLLEVSTDKVDTEVPSPVAG
TLLEIRVPEDETAEVGAVLAVIGSANAAPAKEEAPAAAPAPAKAEAPAAPAAPASEANNE
SGYVTPLVRRLANQNNIDIASVKGTGVGGRIRKQDVLDAVAAQETSAPTAAPAAAKPAAP
SVEVSSLRGTEEKAPRIRQVIARRMRESLDVSTQLTQVHEIDMTRIVKLRASAKANFKAT
NGVNLTYLPFIAKAVAEGLKAHPKLNAEYNEETQKITYHNAEHLAFAVDTDKGLLVPVVS
NAGDLNLAGMASRIADVANRTRTNKIGPDELSGGTFSITNIGSVGALFDTPIINQPQVAI
LGTGAIVKRPMVVTDAEGNDSIAIRHMMYLCLTYDHRLVDGADAGRFLQTVKARLEGGAF
EGELGL
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaccgtaaacctacccgcactgggtgaaagcgttaccgaaggtacggtaacc
cgctggctgaagcaggtcggcgaccgtgtagaggtagacgagccgttggtggaagtatcc
actgacaaggtagacactgaagttccttcgccggttgctggcatcattgaggaaatcttc
gtagcagaagacgaggacgcagaagttggcgcccctctggttcgcattggcgacggttcc
ggctccggcgagtccgcaccagctgctgaagaagcaccggctgctgaagaggcacctgct
gctccggctgctgaggaagctcctgctgctccagctgctgaagaagctcctgctgccgca
ccggctgacggcgctgcatcgggcaccgaagttacccttccagctctgggcgagtcggtt
accgaaggtaccgtcacccgttggttgaaggaagttggcgaagaagtttccgtcgacgag
ccactgcttgaggtttcgaccgacaaggttgacaccgaagttccttccccagttgctggt
accttgctggaaatccgcgttccagaagacgagaccgctgaagttggcgccgttcttgct
gtaatcggttccgctaacgcagcgccagccaaggaagaagcaccagctgctgctccagct
ccagctaaggcagaagctcctgccgctccagccgctccagcctctgaagcgaacaacgag
tccggctacgtcaccccactggtacgccgcttggctaaccagaacaacatcgatatcgct
tcggtgaagggtaccggcgttggcggtcgcatccgcaagcaggatgttctggacgctgta
gctgctcaggaaacttctgcgccgactgctgctcctgctgctgccaagccagctgctcct
tccgttgaggtttcctcgctgcgcggcaccgaggaaaaggctccacgtatccgccaggtt
atcgctcgccgcatgcgcgagtcgctggacgtttcgactcagctgacccaggtccacgag
atcgatatgacccgtatcgtgaagctgcgcgcttcggccaaggccaacttcaaggccacc
aacggtgtgaacctgacatacctgccattcatcgccaaggctgttgccgaaggcctgaag
gcacaccctaagttgaacgctgagtacaacgaagagacccagaagatcacttaccacaat
gccgagcacctggcatttgcagtcgataccgacaagggcctgctggttcctgttgtatcg
aacgctggcgatctgaacctggctggcatggcttcgcgcattgctgacgtggcaaaccgc
acccgtaccaacaaaattggtccagacgagctgtccggtggcaccttctcgatcaccaac
atcggttcggttggcgcactgttcgataccccgatcatcaaccagccacaggtcgcaatt
ctgggcaccggtgcgatcgtgaagcgtccaatggtcgttaccgatgcagagggcaatgat
tcgattgccatccgccacatgatgtacctgtgcctgacctacgatcaccgtctggttgat
ggcgccgatgcaggtcgcttcctgcagaccgtcaaggctcgccttgagggtggcgctttc
gaaggcgaactgggactgtaa

DBGET integrated database retrieval system