KEGG   Arthrobacter arilaitensis: AARI_20280Help
Entry
AARI_20280        CDS       T01320                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aai  Arthrobacter arilaitensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:aai01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:aai00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:aai00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2309105..2310745
Genome map
AA seq 546 aa AA seqDB search
MSETVNLPALGESVTEGTVTRWLKQVGDRVEVDEPLVEVSTDKVDTEVPSPVAGIIEEIF
VAEDEDAEVGAPLVRIGDGSGSGESAPAAEEAPAAEEAPAAPAAEEAPAAPAAEEAPAAA
PADGAASGTEVTLPALGESVTEGTVTRWLKEVGEEVSVDEPLLEVSTDKVDTEVPSPVAG
TLLEIRVPEDETAEVGAVLAVIGSANAAPAKEEAPAAAPAPAKAEAPAAPAAPASEANNE
SGYVTPLVRRLANQNNIDIASVKGTGVGGRIRKQDVLDAVAAQETSAPTAAPAAAKPAAP
SVEVSSLRGTEEKAPRIRQVIARRMRESLDVSTQLTQVHEIDMTRIVKLRASAKANFKAT
NGVNLTYLPFIAKAVAEGLKAHPKLNAEYNEETQKITYHNAEHLAFAVDTDKGLLVPVVS
NAGDLNLAGMASRIADVANRTRTNKIGPDELSGGTFSITNIGSVGALFDTPIINQPQVAI
LGTGAIVKRPMVVTDAEGNDSIAIRHMMYLCLTYDHRLVDGADAGRFLQTVKARLEGGAF
EGELGL
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaccgtaaacctacccgcactgggtgaaagcgttaccgaaggtacggtaacc
cgctggctgaagcaggtcggcgaccgtgtagaggtagacgagccgttggtggaagtatcc
actgacaaggtagacactgaagttccttcgccggttgctggcatcattgaggaaatcttc
gtagcagaagacgaggacgcagaagttggcgcccctctggttcgcattggcgacggttcc
ggctccggcgagtccgcaccagctgctgaagaagcaccggctgctgaagaggcacctgct
gctccggctgctgaggaagctcctgctgctccagctgctgaagaagctcctgctgccgca
ccggctgacggcgctgcatcgggcaccgaagttacccttccagctctgggcgagtcggtt
accgaaggtaccgtcacccgttggttgaaggaagttggcgaagaagtttccgtcgacgag
ccactgcttgaggtttcgaccgacaaggttgacaccgaagttccttccccagttgctggt
accttgctggaaatccgcgttccagaagacgagaccgctgaagttggcgccgttcttgct
gtaatcggttccgctaacgcagcgccagccaaggaagaagcaccagctgctgctccagct
ccagctaaggcagaagctcctgccgctccagccgctccagcctctgaagcgaacaacgag
tccggctacgtcaccccactggtacgccgcttggctaaccagaacaacatcgatatcgct
tcggtgaagggtaccggcgttggcggtcgcatccgcaagcaggatgttctggacgctgta
gctgctcaggaaacttctgcgccgactgctgctcctgctgctgccaagccagctgctcct
tccgttgaggtttcctcgctgcgcggcaccgaggaaaaggctccacgtatccgccaggtt
atcgctcgccgcatgcgcgagtcgctggacgtttcgactcagctgacccaggtccacgag
atcgatatgacccgtatcgtgaagctgcgcgcttcggccaaggccaacttcaaggccacc
aacggtgtgaacctgacatacctgccattcatcgccaaggctgttgccgaaggcctgaag
gcacaccctaagttgaacgctgagtacaacgaagagacccagaagatcacttaccacaat
gccgagcacctggcatttgcagtcgataccgacaagggcctgctggttcctgttgtatcg
aacgctggcgatctgaacctggctggcatggcttcgcgcattgctgacgtggcaaaccgc
acccgtaccaacaaaattggtccagacgagctgtccggtggcaccttctcgatcaccaac
atcggttcggttggcgcactgttcgataccccgatcatcaaccagccacaggtcgcaatt
ctgggcaccggtgcgatcgtgaagcgtccaatggtcgttaccgatgcagagggcaatgat
tcgattgccatccgccacatgatgtacctgtgcctgacctacgatcaccgtctggttgat
ggcgccgatgcaggtcgcttcctgcagaccgtcaaggctcgccttgagggtggcgctttc
gaaggcgaactgggactgtaa

DBGET integrated database retrieval system