KEGG   Arthrobacter arilaitensis: AARI_21170Help
Entry
AARI_21170        CDS       T01320                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
aai  Arthrobacter arilaitensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aai00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2406412..2407338
Genome map
AA seq 308 aa AA seqDB search
MFKPDFLAPVHEFSQRTLDFSQRIAVMAVINRTPDSFFDAGSTFGLDDAVAAAMRAVDAG
ADWVDIGGVPFSPGPELPWQEEAERIVPVIQQVRQRSTVIISADTFHPQVAQAAINAGAD
VINDTTGFSYPELARVVAANNVHVVITHSLAEPRTIYPRPHYEDVVKEIRQYLVQKVQIA
LDAGVAPEKIIIDPGHDLNKNTRHTLDLTAGFQAFADLGYPALAAVSNKDFIGETLDLPK
SERMVGSMVAATICAMNGARILRMHNIPESVQTVHLIEAAQGWREPAYQIHNMGDVNPPA
HPEREASK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagcctgacttcttggctcctgtccatgaattttctcagcgcaccttggatttc
tcgcagcgcattgccgtgatggcagtgatcaaccgcaccccggattctttctttgatgcc
gggtcgacctttggcttggatgatgcggtagccgcggccatgcgtgccgttgatgcaggt
gccgattgggtggatatcggcggggtccctttctctcctggccctgagcttccgtggcag
gaagaagctgagcgtattgtgccggtgatccagcaggtgcgtcagcgcagtaccgtgatc
atttcggcagacaccttccacccgcaagtagcgcaggcagccatcaacgccggcgcagat
gtcatcaacgacaccaccggtttttcctacccggagttggctcgcgtggttgcagcaaac
aatgtccacgtggtcatcacccattcgctggccgagccccggaccatttatccgcgcccg
cactacgaggatgtggtcaaggaaatccgccagtacctagtccagaaagtgcagattgcc
ttggacgccggtgttgcaccggagaagatcatcattgatcccggtcatgatctgaacaag
aacacacgccatactctcgatctgacagccgggttccaggccttcgctgacttgggatat
ccggcgttggccgcggtgtcgaacaaggacttcattggagagaccttggacttgcccaag
agcgaacgcatggtcggctcaatggtggccgcaaccatctgcgccatgaatggtgcccgc
attttgcggatgcacaatatcccggagtcagtgcagaccgtgcacctgatcgaagctgca
caaggttggcgggagccggcctaccagattcacaacatgggcgatgtcaatcctccggcc
catcccgaacgcgaagccagcaagtaa

DBGET integrated database retrieval system