KEGG   Arthrobacter arilaitensis: AARI_21440Help
Entry
AARI_21440        CDS       T01320                                 

Gene name
hemB
Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
aai  Arthrobacter arilaitensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AARI_21440 (hemB)
Enzymes [BR:aai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     AARI_21440 (hemB)
Exosome [BR:aai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AARI_21440 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2442998..2443981)
Genome map
AA seq 327 aa AA seqDB search
MGFPQHRPRRLRQNPAIRRLVAENELSARQLILPAFVREGLAEPNEITSMPGVYQHTMDS
LKAAASNAAELGLGGIMLFGIPEVRDENGSAGLDPQGILNRGIAAVRAEVGDELVAMSDV
CLDEFTSHGHCGVLDAQGGVDNDATLEIYGQMAVAQAEAGAHMLGPSGMMDGQIGVIREA
LDAAGRQDVSILAYSAKYASAFYGPFREAVDSQLVGDRRTYQMDSANRSEAVLEAELDIA
EGADMIMVKPAMSYLDIVRDIADISPVPVSAYQISGEYSMIEAAAANGWIDRKASVLESL
LSIKRAGAQQILTYYAAEVAGWLKEGK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgggtttccctcagcatcgcccgcgccggttgcggcagaatcctgccatccgccgtttg
gtggcagaaaatgagctttcggcacgccaactgatcttgcctgccttcgtgcgcgaggga
ctggccgagcccaacgagatcacctccatgccaggggtctaccagcacaccatggactcg
ctgaaggctgccgcgtcgaacgcggccgagctgggcctgggcggcatcatgctcttcggc
atcccggaagtacgcgacgagaacggttcagccggtcttgacccgcagggcatcttgaac
cgcggcattgcagcggtacgcgccgaagtaggcgatgaactggtggccatgtccgatgtc
tgcctggacgaattcacctcgcacggccactgcggcgtgctcgatgcccagggcggcgtg
gataacgatgccaccttggaaatctacggccagatggctgtggcccaggccgaggctggc
gcccacatgctgggcccctcgggcatgatggatggccagatcggcgtgatccgtgaagca
ctggatgctgccggacgccaggatgtgtccatcctcgcctatagcgccaagtacgccagc
gcgttctacggcccgttccgcgaggccgtggattcccagctggtgggggaccgccgcact
taccagatggattcggccaaccgcagcgaagctgtgctggaagctgaactggatattgcc
gaaggcgcggacatgatcatggtcaagccggccatgagctacttggatattgtgcgcgat
attgccgatatttccccggttccggtctccgcctaccagatctccggcgagtactcgatg
atcgaggccgcagccgccaacggctggattgaccgcaaggcctccgtgcttgaatcgctg
ctgtcgatcaagcgtgcaggcgcccagcagattttgacgtactacgccgccgaagttgcc
ggctggctcaaggaaggtaaataa

DBGET integrated database retrieval system