KEGG   Arthrobacter arilaitensis: AARI_23750Help
Entry
AARI_23750        CDS       T01320                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aai  Arthrobacter arilaitensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AARI_23750 (pfkA)
   01230 Biosynthesis of amino acids
    AARI_23750 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AARI_23750 (pfkA)
   00030 Pentose phosphate pathway
    AARI_23750 (pfkA)
   00051 Fructose and mannose metabolism
    AARI_23750 (pfkA)
   00052 Galactose metabolism
    AARI_23750 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    AARI_23750 (pfkA)
Enzymes [BR:aai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AARI_23750 (pfkA)
Protein phosphatases and associated proteins [BR:aai01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AARI_23750 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2678572..2679600
Genome map
AA seq 342 aa AA seqDB search
MRIGIMTSGGDCPGLNAVIRGAVLNGIKSYDYEFVGFRDGWRGVKEGDFFDLPRTAVRGI
AKQGGTILGTSRTNAFEGELGGPENIANILKTNSIDALIAIGGEGTLAGAQRLCEAGLPI
VGVPKTIDNDLDATDYTFGFDTANQIAVEAIDRLRTTGDSHHRCMVAEVMGRHVGWIALH
AGMASGAHAVLIPEVSTSMEQICQWVNEAHERGRAPLVVVAEGFVPEGMEEAFSVRGVDT
FGRARLGGIGEMLAPIIEERTGIETRATVLGHIQRGGVPTAFDRVLATRLGMAAVDSVNE
QAWGTMVALHGTKVLRVPLRAALNNLKRVPMERYEEAAVLFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattggaatcatgacctcaggtggcgactgccccggtctgaacgctgttatccgc
ggtgcggtactgaacggcatcaaaagctacgactacgaattcgtcggttttcgcgatggc
tggcgcggcgtcaaggaaggcgacttcttcgaccttccccgaaccgctgtgcggggcatt
gccaagcagggcggcaccattctgggcacctcgcgcaccaacgcttttgaaggggaactt
ggcgggcccgagaacatcgccaatatcttgaagaccaacagcatcgacgcgctgattgcc
atcggcggcgaaggcaccttggctggagctcagcgcttgtgcgaagccggtctgccaatt
gttggcgttcccaagaccatcgataatgacttggacgccaccgattacacgttcggtttc
gataccgctaaccagatcgccgtagaagccattgaccgtctgcgcaccactggcgactcg
caccaccgctgcatggtggccgaggtaatgggccgccacgttggctggattgccctgcat
gcgggcatggcttccggtgcccacgcggtgctcatcccagaagtctccaccagcatggag
cagatctgccagtgggtcaacgaagcccatgagcgcggacgtgcgccattggtagttgtt
gctgaaggctttgtgcctgaaggcatggaagaagccttctccgttcgtggcgttgatact
ttcgggcgtgcccgcctgggcggcatcggtgaaatgctcgccccgatcattgaagaacgt
accggcattgaaacgcgtgcgacggtgctgggccacatccagcgcggtggcgtacctacc
gcgttcgaccgcgtgctggccacgcgcttgggcatggctgccgttgattcggtcaacgaa
caggcatggggcaccatggtcgcattgcacggcaccaaggtgctgcgcgtgccactgcgc
gcggccctgaacaacctcaagcgtgtcccgatggaacgctatgaggaagctgccgtactc
ttcggctaa

DBGET integrated database retrieval system