KEGG   Arthrobacter arilaitensis: AARI_27050Help
Entry
AARI_27050        CDS       T01320                                 

Definition
Zn-dependent alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
aai  Arthrobacter arilaitensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AARI_27050
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AARI_27050
  Lipid metabolism
   00071 Fatty acid degradation
    AARI_27050
  Amino acid metabolism
   00350 Tyrosine metabolism
    AARI_27050
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AARI_27050
   00626 Naphthalene degradation
    AARI_27050
Enzymes [BR:aai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AARI_27050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3038906..3040003)
Genome map
AA seq 365 aa AA seqDB search
MRQIQAAVLEHAQNQKPYAEHQPLVIRQLQLEEPGPGEVLVRITAAGLCHSDLSVIDGNR
PRPLPMVLGHESAGIVEQVGRGVDLAIGQQVISVFLPRCEKCDACATGGKLPCSAGSQSN
AEGTLLGGARRLFLDGTPVHHHLGVSAFASHAVMDARSLIPVGADVPAPVAAVLGCAVLT
GGGALRNAAKATGDQDIAIVGLGGVGMAALLVAAGQRTTGKILAIDANEEKLAIARELGA
DDACTPQQAEGRTAQIVIEAAGHPRAFETAMQVSAVGSTVVTVGLPAPGAMSSIEPLALT
AGARTVIGSYMGSALPARDIPCYEQLWCEGKLPLEKLVKTRALAEINQALDELAEGRSVR
QVLLA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcgccagatccaagccgcagtgcttgagcacgcacagaaccagaaaccctacgccgag
caccagccgctggtgatccgccagctgcagctggaggaacccgggcctggcgaagtgctg
gttcgcatcaccgccgctggcctgtgccattctgacctgtcggtcatcgacgggaaccgt
ccgcggcccctgccgatggttctgggccacgaatcagccgggatcgttgaacaggtgggc
cggggcgtggatctggcaatcggccagcaggtgatctccgtcttcctgccgcgctgcgaa
aaatgcgatgcctgcgccaccggcggcaagctgccgtgcagcgccggaagccagtccaat
gccgagggcacactgctaggtggcgctcgccggctgtttctggacggaaccccggtgcac
caccacctcggtgtttccgcctttgccagccatgcggtgatggatgcgcgcagcctcatc
ccggtaggagcagacgttcctgctccggtagcggccgtgctgggctgtgccgtgctgacc
ggaggaggagcgttgcgcaacgccgcgaaggcaaccggtgaccaggacattgccatcgtt
ggccttggtggagtgggcatggccgccttgctggtagctgcgggacagcgaaccaccggg
aagatcttggcaatcgacgccaatgaagaaaaactggccatcgccagggaacttggcgcc
gatgatgcctgcaccccgcagcaagcagaaggacgcaccgcgcagattgtcatcgaagca
gccggtcacccgcgggccttcgaaaccgcaatgcaggtcagtgccgtggggtccaccgtg
gtgaccgtggggttgccagctcccggggcgatgagcagcatcgagccattggcgctgacc
gcgggggcgcgtacggtgatcggcagctatatgggttcggccttgccggcgcgggacatt
ccctgctatgagcagctttggtgtgaaggcaagcttccactggaaaagctcgtgaagacc
agagcgctggctgaaatcaatcaggcgctggatgagttggcggaaggccgttcggtgcgc
caggtgcttttggcctga

DBGET integrated database retrieval system