KEGG   Glutamicibacter arilaitensis Re117: AARI_27370Help
Entry
AARI_27370        CDS       T01320                                 

Gene name
hemD
Definition
(GenBank) putative uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
aai  Glutamicibacter arilaitensis Re117
Pathway
aai00860  Porphyrin and chlorophyll metabolism
aai01100  Metabolic pathways
aai01110  Biosynthesis of secondary metabolites
aai01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AARI_27370 (hemD)
Enzymes [BR:aai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AARI_27370 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: CBT76948
UniProt: E1VZ95
Position
3075604..3076704
Genome map
AA seq 366 aa AA seqDB search
MNTPKPLAGFRLAVTSDRRSAELIEAFERRGAEVTHTPLLQLAPLDDEQQLISQTQKLIE
ARPQIVVITTAYGLRRWVDTAEAAGLGDQLLGTLGQAQLYVRGAKAHGTVKALGLEPAAV
AKDGRSASMLTLLEGKLQGLTVALQLHADSDHGMPHSLRELGASRVLKVEPYRWQDTSSD
SGISALVEGLCAAHFDAVTFTSAPSVHALFAAAKARNRLPALLRSLAERVVVATVGPVTA
APLIEAGISPLVPERHRMGAMIGQLVEHLGSLGTLQAETVFGPVQLRGRTFSVQGQDCEL
TPGQAELVRALIEAGGSVLSRDELGAAMPEASSKHALDMTLSRLRKALPQPEIIATVIKR
GYRLNT
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaatacccccaaacccttggccgggttccgcctggccgtaaccagtgaccgacgctcg
gcagaacttatcgaagcctttgaacgccgtggtgccgaagtcacccatacgccgctgctt
cagctggcgccgttggatgatgagcagcagctgatctcccaaacgcagaagctgatcgaa
gcccggccgcaaatagttgtcattactaccgcctacggattgcggcgctgggtagatacc
gccgaagccgccggtctcggcgatcaactgctcggaaccctgggacaggcgcagctgtac
gtgcgcggcgccaaagcccacggaaccgtcaaggcgctgggcctggaaccagccgccgtg
gccaaggatggacgcagcgcctcgatgctgacgctgttggaaggcaaattgcaaggactg
accgttgccctgcagctgcacgccgattcggatcatggaatgccgcatagcctacgcgag
ctgggtgctagccgggtactgaaggtcgagccgtaccgctggcaggacaccagcagcgat
agtggaatttctgcgctggtcgaaggtctatgtgccgcgcactttgatgcggtgacattc
accagcgctccaagtgtgcatgcgctgttcgctgccgccaaggcacgcaaccgcttgcca
gccttgctgcgctccttggccgaacgcgtggtggtggccaccgttggtccagtgaccgct
gccccgctgattgaagcggggatttccccattggttcccgaacggcatcgcatgggtgcc
atgatcggccagttggtggaacacctgggctcgctgggcaccctgcaggccgagacagtt
ttcggtcctgtccagctgcgcggacgcaccttctcggtgcagggccaggactgcgaactg
acccccggacaggccgaactggtgcgcgcgctgattgaggctggaggaagtgtcttgtcc
cgtgatgagttgggtgcggcaatgcccgaagccagttccaagcacgccctggacatgacc
ctcagccgcctgcgcaaggctttgccgcaaccggaaatcattgccacggtcattaaacgt
ggatacaggttgaatacctga

DBGET integrated database retrieval system