KEGG   Arthrobacter arilaitensis: AARI_33430Help
Entry
AARI_33430        CDS       T01320                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
aai  Arthrobacter arilaitensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AARI_33430
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AARI_33430
   00630 Glyoxylate and dicarboxylate metabolism
    AARI_33430
Enzymes [BR:aai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AARI_33430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3755471..3757102)
Genome map
AA seq 543 aa AA seqDB search
MSIEITAIPDVADAQQILSNEALAFIEKLHQKFAGTRDELLAARAVRRQQFSAAKSIDFD
PETDSVRTGDWKVAEAPEALRDRRVEITGPASPAKMAINALNSGAKVWLADLEDASTPSW
FNVIDAISNLSAAARGTLAFTDAKSGKSYALRTDAPRAVVVVRPRGWHLPENNVRIDGKP
AVGALVDFGLHFFHNAKVLAESGQGPFYYLPKMEHYLESRLWNEIFTFAQAELGIAHGTV
RATMLIETIPAAFQMDEFLYELRDHAAGLNAGRWDYLFSIIKTFREAGEAFIMPDRSAVS
MTAPMMRAYTELLVKTCHKRGAFAMGGMAAFIPNRREPDVTTAAFDKVREDKTREANDGF
DGSWVAHPDLVELCKEIFDAKLGEKPNQLDRQRPEVEVTAAQLLDVASAPGDVTEAGVRA
NLYVAVNYVAVWLSGNGAVAIHNLMEDAATAEISRSQIWQQIRNKVVAADTGNTITAELV
AGILTEEVERLRSEVDNEEHFNAYYQPAAELIAKLTSGKDEDFADFLTTGAYELLEKEYV
TKP
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgagtattgaaatcaccgccatccccgacgtcgccgatgcgcagcagatcctctcgaac
gaagccctggcgttcatcgagaagctgcaccagaagttcgccggcacccgcgacgagctg
ctcgccgcccgagctgtacgccgccagcaattctccgccgccaagtccatcgacttcgat
ccggaaacagattccgtgcgcaccggcgactggaaggtcgccgaagcccctgaggcgctg
cgcgaccgccgcgtggagatcacaggcccggcctccccggccaagatggccatcaacgcg
ctgaactccggtgccaaggtctggctggccgacctggaagatgcctcgaccccgagctgg
ttcaacgtcatcgacgcgatttccaacctctcggccgccgcccgcggcaccttggccttc
accgatgcgaagagcggaaagtcctacgcgctgcgcaccgacgcgccacgtgcggtcgtc
gtggtccgcccgcgcggctggcacctgccggagaacaatgtgcgcatcgacggcaagcct
gccgttggcgcattggtggacttcggcctgcacttcttccataacgcgaaggtgcttgcc
gaatccggccagggaccgttctactacctgcccaaaatggagcactacctggaatcgcgc
ctgtggaacgagatcttcaccttcgcccaggccgagctgggcatcgcccacggcaccgtg
cgcgccaccatgctcatcgagaccattccggcggccttccagatggacgagttcctctac
gaactgcgcgatcacgccgcgggcctgaacgccggacgctgggactacctgttctcgatc
atcaagaccttccgcgaagccggcgaagcattcatcatgccggaccgctcggccgtgtcg
atgaccgcgccgatgatgcgcgcctacaccgagctgctggtcaagacctgccacaagcgc
ggggccttcgccatgggcggcatggccgccttcatcccgaaccgccgcgaaccggatgtc
accactgccgccttcgacaaggtccgcgaggacaagacccgcgaggccaatgacggtttc
gacggctcctgggtggcacacccggatctggtggaactgtgcaaggagatcttcgacgcg
aagctgggcgaaaagccgaaccagctcgatcgccagcgcccggaggtcgaggtcaccgca
gcccagctgctggacgtggccagcgcccccggcgatgtcaccgaggccggcgtgcgcgcg
aacctctacgtggcggtcaactacgtggccgtgtggctttcgggcaacggtgcggtcgcc
atccacaacctgatggaagatgccgccaccgcggagatctcccgctcgcagatctggcag
cagatccgcaacaaggtggtcgccgccgacaccggaaacaccatcaccgccgaactggtt
gctggcattctcaccgaagaggttgaacgcctgcgctcggaggtcgacaatgaagagcac
ttcaacgcctactaccagccggcagcggaactaatcgcgaaactgaccagcggcaaggac
gaggacttcgcagacttcctcaccaccggtgcctacgaactcttggaaaaggagtacgtg
accaagccatga

DBGET integrated database retrieval system