KEGG   Arthrobacter arilaitensis: AARI_33710Help
Entry
AARI_33710        CDS       T01320                                 

Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
aai  Arthrobacter arilaitensis
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AARI_33710
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    AARI_33710
Enzymes [BR:aai01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     AARI_33710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3790039..3790962)
Genome map
AA seq 307 aa AA seqDB search
MTIETTAPTDTKIVLGSNQYGKAEVRLVKITRDTPRHQIQDLNVTSQLHGDFTAAHIDGD
NSHVVATDTQKNTVYGLARNGVGTVEEFLLQLGEHFTGSFDWVTGGRWAAQQFFWDRIND
HDHAFSQNKSEVRTAVLEIGDDGKKSIVAGLEDLTVLKSTGSEFHGFPVDKYTVLKETTD
RILATDVTARWRYTDQGLEAGIDFDGVYASVRNLLLTRFASTHSYALQQSMFQMGKAVLE
AHPEIAEIRMSLPNKHHFLVDLDAFGQDNPNEVFFAADRPYGLIEATITREETESNHPIW
SNIPAFA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgactatcgaaaccaccgccccaaccgacaccaagatcgtgctcggatccaatcaatac
ggcaaggctgaagtccgcctggtcaagatcacccgcgacacccctcgtcatcagatccag
gacctgaacgtcaccagccagctgcatggcgacttcaccgcggcccacatcgatggcgac
aactcacatgtcgttgccaccgacacccagaaaaacaccgtctacggactggcccgcaat
ggcgttggcaccgtggaggaattccttctccagctcggtgagcacttcaccggctcgttc
gattgggtcaccggaggtcgctgggcagcccagcaattcttctgggatcgcatcaacgac
catgaccatgcgttctcgcagaacaagtcggaggtccgcacagcggtgctggaaatcggc
gacgacggcaaaaagtccattgtggccggcttggaggacctcaccgtgctcaaatccacg
ggcagcgaattccacggtttcccggtggacaaatatacggtcctgaaggaaaccacagac
cgcatcctggccaccgacgtgactgcccgctggcgctacaccgatcagggcctcgaagcg
ggcatcgacttcgatggagtctacgcctcggtgcgcaacctcttgctcacgcgcttcgcc
agcacccattcatacgcactgcagcagagcatgttccagatgggcaaggcggtactcgaa
gcacatccggaaatagccgagatcaggatgtcactgccgaacaagcaccatttcctcgtt
gatttggacgctttcgggcaggataacccgaacgaagtcttcttcgccgctgaccgcccc
tatgggctgatcgaagcgaccatcacccgcgaggagaccgagtcgaatcacccaatctgg
tccaatatcccggcatttgcctaa

DBGET integrated database retrieval system