KEGG   Alternaria alternata: CC77DRAFT_1028146Help
Entry
CC77DRAFT_1028146 CDS       T05291                                 

Definition
(RefSeq) sucrose-6-phosphate hydrolase
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
aalt  Alternaria alternata
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aalt00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CC77DRAFT_1028146
   00500 Starch and sucrose metabolism
    CC77DRAFT_1028146
Enzymes [BR:aalt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CC77DRAFT_1028146
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 638 aa AA seqDB search
MFRSLPLLSVALGGLSTVGAQELPAVLTADIIESMGNNSLFTRWRPTYHFSAPAGWLNDP
CGMMYDPTTETYHLHYQWHPNHVNWGNISWGHATSKDMITWTDVGGWEDDKAQSVGTGPY
PDSDNSSYYGLGIFSGSGQPYNLKGEQDGTLINFYTSVQHLPTNWALPYIPGTESQSIVI
SNDGGKTWEQFAGNPIMTEPPEGWNITGWRDPFVEPWPEMDALLGQEEPHWYMVLGSGIK
GEGGGGRIPFYSAPASNLTDWTFLGALWEPDRNETLGSLVETGTYGFNFEVSNFFSLKDE
DDDVHYYVLMGTEGGNLTWHPRAQWGLWNEGQVTRRENGSAEFTPLSGGAIDSGLLYAVT
SFWDSKNDRRVQWGWANEENNNFAINQQGFQGAMAIPREMYVIKTKDLVNTDAGLTTKGN
TRVVEHSDGTFTGYTLGARALPDVVEGLHGGAEPQTIQTEKTACVSGDVSGNGTSHMHLQ
VTLSDFTGPAGVVVAQSPGHEEQTIVWYSPENYTINVDRSQSSSIEQFANYTMLGYFYPY
TFSNGTTESLHMDIFIDGSLVEVHVNDRFWLTTRIYPSRTDSTGFSIWTGANSTVKASDM
KFWNIETNVFPERPVNSSSELVFDTPEETNNYIWWPGN
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgatctctccctcttctgagcgtggcgctcggaggcctctccactgttggtgcg
caggagttgcccgcagtactgactgccgatatcattgagagcatgggcaacaactccctc
ttcacaagatggcgcccgacttaccacttctctgcaccagcaggatggctgaatgatccg
tgtggtatgatgtacgatcctactacagagacttatcatcttcattaccagtggcatcca
aaccacgtcaactggggtaatatctcttggggtcatgcgacgtccaaagatatgatcact
tggacggacgtcggaggttgggaagacgacaaggcacagtctgtcggtaccggaccctac
cccgactccgacaacagcagttactatggtcttggtatcttttctggctcaggacaaccc
tacaacctgaagggcgagcaagacggtactctcatcaacttctacacttcagttcaacac
cttcccacaaactgggctttgccatatatcccaggaactgagagccagagcattgtcatt
tccaatgacggtggtaagacgtgggagcagtttgccggtaaccctatcatgactgagccg
ccggagggttggaacattactggatggcgcgatccatttgtcgagccttggccggagatg
gatgctctcttgggacaagaggagcctcactggtacatggttctcggctccggtatcaag
ggcgaaggtggaggtggtcgcattcctttctacagtgcccctgccagcaacttgacagac
tggaccttccttggtgccttgtgggagcccgacaggaacgagactcttggttcactggtc
gagactggaacctacggcttcaactttgaagtatcaaacttcttctctctgaaggatgaa
gatgatgacgttcactactacgtccttatgggaacagagggaggtaaccttacctggcac
ccccgtgcacagtggggtttgtggaacgaaggccaggtcactaggagggagaatggctca
gccgagttcacccctctgtccggtggcgccatcgattctggcctactttacgcagtaacc
agtttctgggattcaaagaacgaccgtcgcgtccagtggggttgggcaaacgaggagaac
aacaacttcgccatcaaccagcaaggcttccaaggtgccatggccataccacgagagatg
tatgtcatcaagaccaaggatctggtcaacaccgatgccggcctgaccaccaagggaaac
actcgcgtggtagaacacagtgacggtactttcactggatacaccctgggagctcgagct
ctacctgatgttgtcgaggggcttcatggtggagccgagccacaaaccattcagactgag
aagaccgcttgcgtttccggtgacgtttctggcaatggtaccagccatatgcatctccaa
gttaccctatctgacttcactggacctgctggtgttgtggttgctcaatcgcccggacac
gaggagcagacaatcgtttggtacagccctgagaactataccatcaacgttgaccgctcg
caatcgtcctctatcgagcagttcgccaactacactatgctcggatacttctacccttac
acgttctccaacggtacaaccgagtctctgcacatggatattttcattgatggatcgctc
gtggaggttcatgtaaacgaccgcttctggctgaccactcgcatctacccgtctcgtacc
gatagcacgggtttcagcatatggactggtgccaactctactgtcaaggcttcggacatg
aagttctggaacattgagaccaacgtcttccctgaaaggccagtgaactcaagcagtgag
cttgtcttcgatacacccgaggagacgaacaactatatttggtggcctggaaactag

DBGET integrated database retrieval system