KEGG   Apteryx australis mantelli (brown kiwi): 106492187Help
Entry
106492187         CDS       T04298                                 

Definition
(RefSeq) monoglyceride lipase-like
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:aam00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    106492187
Enzymes [BR:aam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     106492187
Peptidases [BR:aam01002]
 Serine Peptidases
  Family S33
   106492187
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 99 aa AA seqDB search
MKVSFVIQLMNAIARIERALPKLTLPILVLHGSSDKLCDIRGSYLLMDTVQSQDKTLKVY
EEAYHALHKELPEVTTSVFTEILTWVGQKVSAAGETSHT
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctcctttgtcatccagctgatgaacgctattgccagaattgagcgagctctg
cccaagctgactctgcctatcctggtgctacacggctcttctgacaagctctgtgatatc
agagggtcctatttactgatggacacagtgcagagtcaggacaaaacactcaaggtgtat
gaggaagcctatcatgccctccacaaagagctgcctgaggtcactacctctgtcttcaca
gaaatactaacgtgggttggccagaaggtctcagcagctggggaaaccagccatacttaa

DBGET integrated database retrieval system