KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_00024Help
Entry
D7S_00024         CDS       T02046                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
aan00260  Glycine, serine and threonine metabolism
aan00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aan01100  Metabolic pathways
aan01110  Biosynthesis of secondary metabolites
aan01130  Biosynthesis of antibiotics
aan01230  Biosynthesis of amino acids
Module
aan_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aan00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    D7S_00024
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    D7S_00024
Enzymes [BR:aan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     D7S_00024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: AFI85907
Position
complement(22479..23285)
Genome map
AA seq 268 aa AA seqDB search
MSRFETTFAQLHAQNEGAFVPFVTLCDPTFDRSFDIICTLVDNGADALELGFPFSDPLLD
GPVIQAANNRALNAGHSTEDSFKLLEKVRSKYPEIPMSLLLCANLIFAKGLDNFYQRCAD
VGVDAVLVADIPLLAKDDYVAAAKRHGIQPVFICPPNADEKTIQDVAQNSEGYTYLVSRA
GVTGAENQSHAANLDSLVERLKAHNAPPILQGFGIAQPAQVKEALQLGAAGAISGSATVK
IIARNLDNHAQCLTELGEFVRNMKAATK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttttgaaaccacatttgcccaattacacgcgcaaaatgaaggcgcattcgtt
cctttcgtcaccttatgtgatcccactttcgaccgttcttttgacattatttgcaccctg
gtggataacggggcagacgcgttggaactgggcttcccattctccgatcctttattggac
ggaccggtgattcaagccgccaataatcgcgcgttaaatgccggtcacagcacggaagac
agctttaaattgctggaaaaagtgaggtcaaaatatccggagattccgatgagtttgctg
ctttgcgccaatttaatttttgccaaaggtttggataatttctatcaacgttgcgccgac
gtgggcgtggacgccgtgttagttgccgatattcccttattggcgaaagacgattatgtc
gccgccgcgaaaagacacggcattcaacctgtttttatttgcccgccgaatgcagacgaa
aaaaccattcaagatgtggcgcaaaatagtgaaggttacacgtatttggtttcccgcgcg
ggcgtaaccggtgcagaaaatcaaagccatgcggcgaatctggacagcttagtagaacga
ctcaaagcccacaacgcaccgccaattctgcaaggcttcggcatcgcccaaccggcgcag
gtaaaagaagcactgcaactgggcgcggcaggggcgatttccggttccgctacggtgaaa
atcattgcgcgaaatttggataaccacgcccaatgtttaactgaactcggcgaattcgta
cgcaatatgaaagcggcgacgaaataa

DBGET integrated database retrieval system