KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_00025Help
Entry
D7S_00025         CDS       T02046                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
aan00260  Glycine, serine and threonine metabolism
aan00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aan01100  Metabolic pathways
aan01110  Biosynthesis of secondary metabolites
aan01130  Biosynthesis of antibiotics
aan01230  Biosynthesis of amino acids
Module
aan_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aan00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    D7S_00025
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    D7S_00025
Enzymes [BR:aan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     D7S_00025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Mic1
Motif
Other DBs
NCBI-ProteinID: AFI85908
Position
complement(23288..24481)
Genome map
AA seq 397 aa AA seqDB search
MAETILNPYFGEFGGMYVPEILVPVLQQLEKAFVEAKADPAFQREFQDLLKNYAGRPTAL
TLCRNLTKGTNAKIYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVAT
ALACAMLDMPCRVYMGAKDVERQSPNVFRMRLMGTEVVPVQKGSCSLKDACCEAMRDWSA
NYENTHYLLGTAAGPHPFPTIVREFQKMIGEETKRQMLEKEGRLPDTVIAAVGGGSNAIG
MFTDFIDEKEVRLIGVEPAGKGIETGEHGAPLGHAKVGIYFGMKSPLMQTEDGQVEESYS
ISAGLDFPSVGPQHAYLQSIGRAEYPSITDDEALDAFQALAKHEGIIPALESSHALAQAL
KMIRQEPNKAQILVVNLSGRGDKDIFTVDKILNEKGM
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaacgattttaaacccgtatttcggggaattcggcggaatgtatgtgccggaa
attctagtgccggtgttgcaacagttggaaaaagcgtttgtagaagccaaggcggatcct
gcatttcagcgcgaatttcaggatttattgaaaaattatgccggcagacccaccgcactt
accctttgtcgcaatctcaccaaaggcaccaacgccaaaatctatttaaaacgggaagat
ttattacacggcggcgcacataaaaccaaccaggtattaggtcagattttgcttgccaaa
cgcatgggcaaaacccgcattattgccgaaaccggcgcgggacagcacggtgtcgccact
gctctcgcctgcgccatgttggatatgccgtgccgtgtttatatgggcgcgaaagatgtg
gaacgccaatcgccgaatgtgtttcgtatgcgtttaatgggcacggaagtggtaccggtg
caaaaaggttcctgttctttgaaagacgcttgctgcgaagccatgcgtgactggtcggca
aattatgaaaatacgcactatttgctcggcacagcggcaggtccgcacccttttccgact
atcgtgcgtgaattccagaaaatgatcggggaagaaaccaaacgccaaatgctggaaaaa
gaaggtcgtttaccggacacggtaattgcggcagtcggcggtggctcaaatgcgatcgga
atgtttaccgattttattgacgaaaaagaggtgcgtttaatcggcgtggaacctgccggc
aaaggcattgaaacgggcgaacacggcgcgccgttgggccatgccaaagtaggaatttat
ttcggtatgaaatcgccgttgatgcaaacagaagacggtcaagtggaagaatcctattcc
atttcggcaggcttggatttcccttccgtggggccgcaacacgcttatttacaaagcatc
ggtcgcgcggaatacccaagtattaccgatgatgaagcccttgacgcgtttcaggcattg
gcaaaacacgaaggcattattcctgcgttagaaagctcccacgccctcgcccaagcctta
aaaatgatccgtcaggaaccaaataaagcgcaaattttggtggtgaatttgtccggtcgc
ggcgataaagatattttcaccgtagataaaattttaaatgaaaaaggaatgtaa

DBGET integrated database retrieval system