KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_00081Help
Entry
D7S_00081         CDS       T02046                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:aan00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(92677..94872)
Genome map
AA seq 731 aa AA seqDB search
MAQLVAQSVINQFFDGTHGDPFSVLGMHETENGIEIRALLSDASRVLVIEKENQATLCEL
TRLDDRGFFDGVVPNTRNFFAYQLQVYWGKESQIIEDPYRYHPMINDLDQWLLAEGSFLR
PYEVLGAHFIECDGVSGVNFRLWAPNAKRVSVVGDFNYWDGRRHPMRLHPASGVWELFLP
KVSLGQLYKFELIDCHGNLRLKADPYAFSSQLRPDTASQISPLPSVVPMTETRRKANQWD
QPISIYEVHLGSWRRNLENNFWLDYDQIADELIPYVQEMGFTDIEFLPLSEFPFDGSWGY
QPLGLYSPTSRFGTPEGFKRLVERAHDAGINVILDWVPGHFPSDTHGLVAFDGTALYEHA
DPREGYHQDWNTLIYNYGRNEVKNFLSSNVLYWLERFGIDGIRVDAVASMIYRDYSRAEG
QWIPNQYGGRENLEAIEFLKHTNWKIHSEVPGSITIAEESTAFTGVTHPSEQGGLGFNFK
WNMGWMNDTLSYMEKDPVYRQYHHNQMTFGMMYQYSENFVLPLSHDEVVHGKCSLIGKMP
GDAWQKFANLRAYYGYMWGYPGKKLLFMGNEFAQGREWNYRESLDWFLLDEGIGGQWHIG
VQQLVKDLNKIYRENAPLFELDSDPQGFDWLVADDAQNSVFAFERCSRDGERILVISNFT
PVPRHDYRLGVNVAGEYHEILNTDSAYYAGSNVGNLGAVHSEDIASHNRANSISVSIPPL
ATIYLKYQGKA
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggctcaattagtagcacaatcagttattaatcagttttttgacggcacacatggtgat
ccgttttccgtattgggtatgcacgaaaccgaaaacggtattgaaattcgtgccttattg
tctgatgcaagtcgtgttttggtcattgaaaaagaaaatcaggcaacgttgtgtgaatta
acccgtttagatgacagaggcttttttgacggcgttgtaccgaacacgagaaatttcttt
gcatatcaattacaggtgtattggggcaaagagtcacaaataattgaagacccgtatcgt
taccacccgatgattaatgatttggatcagtggttgttagcggaaggttcatttttacga
ccatatgaagtattaggcgcgcattttattgaatgtgacggtgtctcaggtgtgaatttc
cgtttgtgggcgcccaatgccaaacgggtttccgtggtaggcgattttaactattgggac
ggtcgtcgccatccgatgcgcttacatccggcaagcggtgtatgggaattatttctgccg
aaagtctccttggggcaactgtataaatttgaattaatcgattgccacggcaatctccgc
ttaaaggcagacccttatgctttcagttctcaattacgtcccgataccgcgtcacaaatc
agcccgttgccgagtgtcgtgccgatgacggaaacccgtcgcaaagccaatcaatgggat
cagccgatttccatttatgaggtgcatttagggtcttggcgacgtaacttggaaaacaat
ttctggctggattacgatcaaatcgccgacgaattgattccttacgtgcaggaaatgggt
ttcaccgatattgagtttttaccgttatccgagtttccgtttgacggttcctgggggtat
caaccgctcggcttgtattcaccgaccagccgtttcggtacgccggaaggctttaaacgt
ttggtggaacgggcgcatgatgccggcattaacgtgattctcgattgggtgccggggcat
ttcccgagcgatactcacggcttggtggcatttgacggtacggcattgtatgagcacgcc
gatccgcgcgaggggtatcatcaagattggaatacactgatttacaactacggacgcaac
gaagttaagaatttcttatccagtaatgtcttgtactggcttgaacgtttcggtatcgac
ggtattcgcgtcgatgcggtggcgtctatgatttatcgtgattacagccgcgccgaaggg
cagtggattccgaatcaatacggtggacgggaaaacttagaagccattgaatttttgaaa
cataccaactggaaaatccatagcgaagtaccaggttccatcaccattgcggaagaatcc
accgcctttaccggcgtgacccatccgagcgaacagggcggtctgggctttaatttcaag
tggaacatgggctggatgaacgataccttatcctacatggaaaaagatcccgtttatcgc
caatatcaccacaaccaaatgactttcggcatgatgtatcaatacagcgaaaactttgtg
ttgccgctttctcatgacgaagtggtgcatggcaaatgttctcttatcggcaaaatgccg
ggcgatgcgtggcaaaaatttgccaatttgcgcgcctattacggttatatgtggggctat
ccgggcaaaaaattgctatttatgggcaatgaatttgcgcaggggcgtgaatggaattac
cgcgaaagtctggattggttcctgttagatgaaggtattggcggtcaatggcatatcggc
gtacaacagctggtgaaagatctcaataaaatttaccgcgaaaacgcaccgctctttgag
ctggattccgatccgcagggctttgattggctggtggcagatgacgcgcaaaattccgtc
tttgcctttgaacgctgcagccgtgatggcgaacgtattcttgtaatcagcaacttcacg
ccggtgccgcgtcatgattatcgtctcggtgtgaatgttgccggcgaatatcacgaaatt
ttaaatacggactccgcatattacgccggttcaaatgtgggtaatttaggcgctgtacac
agcgaagacatcgccagccataatcgggcgaactccatttccgtctctattccgccattg
gcaacgatctatttaaaatatcagggtaaagcatga

DBGET integrated database retrieval system