KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_00114Help
Entry
D7S_00114         CDS       T02046                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:aan03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(121178..123157)
Genome map
AA seq 659 aa AA seqDB search
MLALLSQLKEKGIINASDYYFAEFIHRKQQPFHYASSIQNLAVLMAALCNFSYRQGNTCI
LLNHATEQDLFGLQDYFNERVYLTDIQQKIDYLSIERWQAALLAAQHIAFTAAPLQQIAP
LVLQFDRLYFYRIWQDEFRIADYFKSAVRFQHVFSAEQMAQIAPILNRYFHEEQSIDWQK
IAVAMALRQRFCLITGGPGTGKTTTATKLLLTLQELHQNSLRIKLVAPTGKAAARLTESI
VDAVDRLKQTFSTEKHEREMIENLRIPMNAETLHRLLGVRFFSEETRYHADNPLPVDVLV
VDEASMIDLTLMAKLLNALKPETKLILLGDKDQLASVEAGAILGELGRFVNASAPAYSPA
MAQYLQATTGSSLAASDSVNPISDSICYLQVSRRFGANPEVGALAAAVNSGDAVKSWQLL
QQYQQHQAKKCGVYLTDFARYLTNKEDSQQRKTCVKLIVERAAEEYRRYLQLILQEGQMN
GEKVRSIFAAFNGIRFLTALRVGEFGVEQLNLAIAEKLRQKRLLQFHQEREWYIGKPIMV
TQNDGNVGLYNGDIGMYLGNGRVWFEQGQNSYKTVLASRVPNHETAFVMTVHKSQGSEFP
HTFLILPLENSPVLSKELVYTGITRTKDFLTVFALQSVWESAVKNPVQRQSGLGQLLEI
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgttagctttattatcccaactcaaagaaaagggcatcatcaacgcctctgactattat
ttcgccgagtttattcaccgcaaacaacagccttttcactatgcatcgtctatccagaac
ctggcggtgcttatggcggcgttgtgcaacttcagttatcggcagggcaacacctgtatt
ttactgaatcacgccacggagcaggatttgttcggcttgcaggattattttaacgaacgc
gtttatttaacggatattcagcaaaaaattgattatttgtccattgaacgctggcaggca
gccttgctggcggcgcaacatatcgctttcaccgccgcgccgttgcaacagatcgcgccg
ttggtgttgcagtttgatcgcttgtatttttatcgcatctggcaggatgaatttcgtatc
gccgattactttaaaagtgcggttcgttttcaacacgttttttcagccgaacagatggcg
caaatcgccccgattttgaaccgctattttcatgaggaacagagcatcgactggcaaaaa
attgcggtggcgatggcgttgcgtcaacgattttgcctcatcaccggcgggccgggcacg
ggcaaaaccactaccgccaccaaactgttattgaccttgcaagagcttcatcaaaacagc
ttgcgcattaaacttgtcgctccgacggggaaagcggcagcacggcttacggaatccatt
gtggacgcggtagatcgcctgaaacagactttttccacggaaaaacacgaacgggaaatg
atcgaaaatctgcgtattcccatgaacgcggaaacccttcatcgcttgcttggcgtgcgt
tttttcagtgaagaaacccgctatcacgccgacaatcctttgccggtggatgtgttggtg
gtggacgaagcgtccatgatcgatttaactttgatggcaaaactgcttaatgcgctcaaa
ccggaaaccaaattgattttattgggtgataaagaccaactggcttctgtggaagcggga
gcgattctaggcgaattgggacgttttgtaaatgcatcggcaccggcgtatagccccgca
atggcacaatatttacaggcgaccacgggcagttctcttgctgcgtcggatagcgtcaat
cctattagcgatagcatttgttatttgcaggtcagccgccgttttggggcaaatccggaa
gtgggtgcgttggcggctgcggtgaattcaggcgacgcggtgaaaagctggcagttattg
cagcaatatcagcaacatcaagcaaaaaaatgcggtgtatatttaactgattttgctcgt
tatttgaccaacaaagaagatagtcagcaacgtaaaacctgcgtgaagctcatcgtggaa
cgtgcggcagaggaatatcgccgttatttacagttgattttacaagaagggcagatgaat
ggagaaaaagtgcggtcgattttcgcggcgtttaacggtattcgttttttaacggcgtta
cgcgtgggcgaattcggcgtggagcaattaaatctcgccatcgcagaaaaattacgccaa
aaacgcctgttgcaatttcatcaggaacgggaatggtacatcggcaaaccgattatggtg
acgcaaaatgatggcaatgtgggcttgtataacggtgatatcggcatgtatttgggaaac
gggcgggtatggttcgagcagggacaaaacagttataaaactgtgctggcaagtcgtgtg
ccgaatcatgaaaccgcattcgtcatgacggtacacaaatcacaaggttcggaatttccg
catacttttctgattttgccgctggaaaacagccccgtgttatccaaagaactggtttac
accggcatcacccgcaccaaggattttttaacggtgttcgcgctgcaaagcgtatgggaa
agtgcggtaaaaaatccggtgcaacggcaaagcggattgggtcaattactggaaatctaa

DBGET integrated database retrieval system