KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_00261Help
Entry
D7S_00261         CDS       T02046                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Brite
Enzymes [BR:aan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     D7S_00261
Secretion system [BR:aan02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   D7S_00261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(271066..271749)
Genome map
AA seq 227 aa AA seqDB search
MKKIITTLSLLAISMSVTANDAALKSKLEKLGVKDIDIQTSPIKGLKTVVSDQGIFYASE
DGEYLLQGKIYKLTDKGISNVTNKVLLDKLNALKNEMIVYPAKNEKHVITVFMDITCHYC
HLLHQQVKEYNDLGITVRYLAFPRAGMESQTAGQMEAIFTAKDPTFALNEAEKGNLPKEL
KTPNVVRKHYLLGAQFGVNGTPTIITSEGEVIGGYLKPADLLAALEG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattattactacgctttctcttttggctatatctatgagtgtaacggcaaat
gatgctgcactgaaaagtaaattggaaaagcttggcgtgaaagatattgatattcaaact
tcaccgattaaaggcttgaaaactgtcgtaagcgaccaaggcattttttacgcaagtgaa
gacggcgaatatttattacaaggtaaaatctacaaattaaccgataaaggcattagcaac
gtcactaataaagtgttgctggataaattaaatgcgctgaaaaatgaaatgattgtgtat
ccggcaaaaaatgaaaaacacgtcattactgtatttatggatattacctgccactactgc
catttgttacatcaacaagtgaaagaatataacgacttaggcattaccgtacgttatttg
gcgttcccgcgtgcaggtatggagagtcaaacggcagggcaaatggaagcgatttttacc
gcaaaagacccgacattcgctttaaacgaagcggaaaaaggcaatcttccaaaagaattg
aagaccccgaatgtggtgagaaaacattatttgcttggcgctcaatttggtgtaaacgga
acgccgactatcattaccagtgaaggcgaagttattggtggttatctaaaacctgctgat
ttacttgcggcgttagaaggataa

DBGET integrated database retrieval system