KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_00312Help
Entry
D7S_00312         CDS       T02046                                 

Definition
(GenBank) hypothetical protein
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    D7S_00312
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D7S_00312
   00020 Citrate cycle (TCA cycle)
    D7S_00312
   00620 Pyruvate metabolism
    D7S_00312
Enzymes [BR:aan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     D7S_00312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(310731..312344)
Genome map
AA seq 537 aa AA seqDB search
MAKQIQIPDIGSDEVTVTEVMVNVGDSVTADQSIINVEGDKASMEVPAPEAGVVKEILVK
VGDKVTTGTPMLVLDSADAASAQAPQAEAPAPQAAPAAAQVVDVNVPDIGGDEVNVTNVM
VKVGDRVEVDQSIINVEGDKASMEVPAPVAGIVKEIIIKAGDKVSTGTLIMRFETAGSAP
AAAPVASSPAAAPAPTEQAVPQAVPAPTAQASAPAAASSSQADVESAKSYAHATPVIRRL
AREFGVNLDKVKGTGRKGRILKEDIQAYVKAAVKALESGAAATGAANGAGLGLLPWPKVD
FSKFGEIEEVELSRINKISGANLHRNWVMIPHVTHFDKADITELEAFRKEQNVLSEKQKL
GVKITPVVFIMKAVAKALEAFPRFNSSITEDAQRLILKKYINVGVAVDTPNGLVVPVFKD
VNKKGIIELSRELMEVSKKARDGKLTAADMQGGCFTISSLGGIGTTHFAPIVNAPEVAIL
GVSKSAMEPVWNGKEFAPRLILPISLSFDHRVIDGADGARFISYIGSVLADLRRLIM
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggctaaacaaattcaaatcccggatatcggtagtgatgaagttaccgtaaccgaagtg
atggtaaacgttggagatagcgtcaccgcggatcaatccattattaatgttgaaggtgat
aaagcttctatggaagtaccggcaccggaagcgggcgtggtaaaagaaattttagtaaaa
gtgggcgacaaagtgactaccggcacgccgatgttggtgttagatagtgccgatgccgca
tcggctcaagcgcctcaagctgaggcacctgcaccgcaagccgcgcctgctgccgcacaa
gtggtggatgttaatgtacctgacatcggcggtgacgaagtgaacgtgaccaatgtgatg
gtgaaagtgggtgatcgtgttgaagtggatcaatcgattattaatgttgaaggtgataag
gcttctatggaagtaccggcaccggtggcgggtatcgttaaagaaattattatcaaagcc
ggcgataaagtgtccacaggcactttaatcatgcgttttgaaacagcgggcagtgcgcct
gcagctgctccggtagcttcttcgcctgctgcagcgccggcaccgactgagcaagcagta
ccacaagctgtgcctgcaccgacagcacaggcttccgcgccggcagccgcatcttcttcc
caagcggatgttgaaagtgcgaaaagctatgcgcacgccacaccggtgattcgtcgttta
gcgcgcgaattcggtgtgaacctggataaagtgaaaggcacaggtcgtaagggtcgtatt
ttaaaagaagatattcaagcctatgtgaaagccgccgtgaaagctttggaaagcggtgct
gcggcaacaggcgctgcaaatggtgccggtttaggcttgttaccgtggccgaaagtggat
ttcagcaaattcggcgaaatcgaagaagtggaattaagtcgtatcaacaagatttccggt
gcgaacttacatcgtaactgggtcatgattccgcatgttacccatttcgataaagcggac
atcaccgagttggaagcattccgtaaagagcaaaacgtcttgtctgaaaaacaaaaactg
ggcgtgaaaatcacccctgtggtcttcattatgaaagccgttgccaaagcgttggaagcc
ttcccgcgtttcaacagttccattaccgaagatgcacaacgtttgatcctgaaaaaatac
atcaatgtgggcgtggcggtagatacgccgaacggtttagttgtaccggtctttaaagat
gtcaacaaaaaaggcattatcgagctttcccgtgaattgatggaagtgtccaaaaaagcc
cgtgacggtaaattaaccgcagcggatatgcaaggcggttgtttcaccatttccagcctt
ggcggcattggtacaacacattttgcaccaatcgtgaatgcacctgaagtggcgattttg
ggtgtctccaaatccgctatggaaccggtttggaacggtaaagaatttgcgccgcgcttg
attctgccgatttccttatctttcgaccaccgtgttattgacggtgcggacggtgcacgc
ttcatcagctacatcggttccgtattagccgacttacgtcgtttaattatgtaa

DBGET integrated database retrieval system