KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_00318Help
Entry
D7S_00318         CDS       T02046                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aan00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    D7S_00318
Enzymes [BR:aan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     D7S_00318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
321891..323966
Genome map
AA seq 691 aa AA seqDB search
MSIKEKRFDQAGIMPYFFDERGLKIRAPLAIKKALLSTFEGHVTSRTHPLPPVKILRQNQ
PHFLPLNVSDATRSWQGKWQLHLEDGTCILEGKVKKNSITLPRDLPLGYHDLVLHGGKEE
VHCRLIVAPQRCYEPEAFAEQKKLWGSFIQLYTLKSARNWGVGDFGDLQEFIRGLAPYQA
DFLGLNPIHALFPGNPDGASPYSPSSRKWLNIIYINIDQLPEFQQSAEAQRWFNSAEVQE
KLNALRAAEWIDYAEVMVLKLKGLHFAFAEFKANPTALSQHAFADFVRNGGESLQVQATF
DALHAHLSARYREQWGWDFWAPEFQDYHSEVVAQFRRQYGEKIEFYTWLQFCADQQLAEC
DALCKAQQMTIGMYRDLAVGVTGSGSETWSDKELYCLRASVGAPPDVLGPQGQNWGLTPM
NPHILKQRVYQPFIDLVRANMNHCGALRIDHIMSLLRLWWIPKGDSAVNGAYVHYPVDDL
IAILALESQRRSCVIIGEDLGTVPKEIVSKLKNAGILSYKIFYFEFDKQGQSRNLRDYPY
QAMTTLSTHDLPTINGYWRSYDFELGQKYGVYPNRQILEILKKGRVKAKAGILQRLKEHD
IDVDTGINETLSSDVNKKFVHQLQSYVAEVNSALFGFQPEDWLGMTEPVNIPGTSMQYAN
WRRRLTQNTDAIFADQDIQKLLKEVNAKRKG
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgtctattaaagaaaaacgcttcgaccaagcgggcatcatgccctacttttttgacgaa
cgagggctgaaaattcgcgcgccgcttgctattaaaaaagccttgctttccacttttgaa
ggtcatgtaaccagccgtactcacccgctgccgccggtgaaaattctccgtcaaaatcaa
ccgcactttttgccgttaaacgtctccgatgccacccgttcatggcaaggcaaatggcag
cttcacctggaagacggtacctgcatccttgaaggcaaagtgaaaaaaaatagcataacc
ctgccgcgcgatttgccgttggggtatcacgatttggtgttgcatggtggaaaagaagaa
gtgcattgccgccttatcgttgcgccgcagcggtgttatgaaccggaagcattcgccgaa
cagaaaaaactctggggcagctttattcaactttacactctgaaatcggcgcgcaactgg
ggtgtgggcgatttcggtgatttgcaagaatttattcgcgggcttgcgccgtaccaagcg
gattttttaggcttaaacccaattcatgccctgtttccgggcaatcccgatggtgccagc
ccgtatagcccgtcgtcacgcaaatggctgaacatcatttacatcaacatagatcaactg
ccggaatttcaacaaagcgcagaggcgcaacgctggtttaactcggcagaagtgcaggaa
aaattgaacgccttacgcgccgccgaatggattgattacgccgaggtgatggtgttgaaa
ttgaaagggctgcattttgcctttgccgaatttaaagcaaatccgaccgcactttcccaa
catgcttttgccgatttcgtgcgcaacggcggcgaaagtttacaggtgcaagccactttt
gatgcgctacacgcccatttaagcgcccgttatcgcgagcaatggggctgggatttctgg
gcgccggagttccaggattatcattccgaggtcgtcgcccaattccgtcgtcaatatggt
gagaaaatcgaattttatacctggttgcaattctgcgccgaccaacaacttgccgaatgc
gatgccttatgtaaagcgcaacaaatgaccatcggtatgtaccgcgatttggcggtgggc
gtcaccggtagcggttcggaaacctggagcgataaggaattgtattgtctgcgggcgtcc
gtgggcgcgccgcccgatgtgttaggtccgcaaggacaaaactggggcttaacgccgatg
aatccgcacattctgaaacaacgcgtttaccagccgtttatcgacttggtacgcgccaat
atgaatcattgcggcgcattgcgtatcgatcacattatgtcgttgttgcgtttgtggtgg
atcccgaaaggcgacagcgcggtcaacggcgcctatgtgcattatccggtcgatgatttg
attgctattctcgcccttgaaagccaacgccgcagctgtgtgattatcggcgaagattta
ggcaccgtgccgaaagaaatcgtcagcaaactcaaaaatgccggcattttgtcttacaaa
atattctattttgaattcgataaacagggacaaagtcgcaacctgcgggactatccgtac
caagctatgacaactctaagcacccacgatctgccgaccattaacggttattggcgcagt
tatgattttgagttggggcaaaaatacggcgtgtatccgaatcgacaaattctggaaatt
ctgaaaaaaggtcgcgtgaaggcgaaagcgggtatcctgcaacgcttgaaagaacatgat
attgacgtggacaccggcattaacgaaaccttgtcttccgatgtaaacaaaaaattcgtc
catcagctgcaatcttacgtcgccgaggtcaacagcgccctgttcggcttccaaccagaa
gactggctgggtatgaccgaaccggtcaacattccgggcaccagtatgcaatacgccaac
tggcgccgccgtttaacgcaaaacaccgacgcaatttttgccgatcaagacattcagaaa
ttgctgaaagaagtgaacgctaaacgtaaagggtaa

DBGET integrated database retrieval system