KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_00326Help
Entry
D7S_00326         CDS       T02046                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    D7S_00326
Enzymes [BR:aan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     D7S_00326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(329728..330228)
Genome map
AA seq 166 aa AA seqDB search
MNKVYVALGSNLADPQAQLVAALRAMNQLPDSRLISVSSFYQSKPLGPQDQPDYANAVAC
LETALSPFALLDELQRIEQEQGRVRLRRWGERTLDLDILLYAEQTIQSERLTVPHYDMHN
REFVIIPLAEIAPSFSLPNGQSIRELMQNFTHHQMVIVKEKGEVVF
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggtgtatgtcgctttaggcagtaatttggcggatccgcaagcacaactggtc
gccgcattacgggcgatgaatcaattgcctgacagccgtctgattagcgtcagttctttt
tatcaaagcaaacctctcggtccgcaagatcagcctgattatgccaacgccgtcgcttgc
ctggaaacggcgctttctcccttcgcattgcttgatgaattacaacgtattgaacaggaa
caagggcgtgtccgtcttcgtcgttggggtgagcgcacattagatttggatattttgctt
tacgccgagcaaaccattcagtcggaacgtctgactgttccccattatgatatgcacaat
cgtgaatttgtaattatcccgttggcggaaatcgcaccgtcgttttccttgccgaacggg
caatccatcagggagttaatgcaaaattttacccatcatcaaatggtgattgtgaaagag
aagggcgaggttgtgttttaa

DBGET integrated database retrieval system