KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_00493Help
Entry
D7S_00493         CDS       T02046                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aan00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    D7S_00493
Enzymes [BR:aan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     D7S_00493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
490500..491411
Genome map
AA seq 303 aa AA seqDB search
MKTYQFSTALFTPETLQSEQGVRFPCPAKLNLFLYINGKRADGYHELQTLFQFVDFGDWL
HIKARSDGKIRLTPAIANLKSEDNLIYRAAKLLQQYTGCTLGAELTLDKILPIGGGVGGG
SSNAATTLVALNHLWKTGLSTGQLAELGLTLGADVPIFVHGKAAFAEGIGEKITHCEPPE
KWYLVLKPNVSISTAVVFSDPHLPRNTPKKSLSQLLMGKYANDCEKVVRDHYSEVEESLN
WLVKYAPARLTGTGACVFAEFDDKKSAQSVLQAKPKNCFGFVAKGLNHSPLHEMLKNVPD
STN
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacttatcaattttccaccgcacttttcacgcccgaaaccttgcaaagcgaacag
ggtgtacgcttcccctgcccggcgaagctgaatctttttttgtacattaacggcaagcgg
gcggacggttaccacgaattacaaaccctgtttcagtttgttgatttcggcgattggcta
cacatcaaagcgcgctcggacggcaagattcgtttaacccccgccatcgccaatttaaaa
tcggaagacaatttaatttatcgcgcggcaaaattgctgcaacagtataccggctgcacg
ctgggcgccgagttaaccttagataaaatcctgccgatcggtggcggcgtgggtggcggt
tcatccaatgcggcaacgacattggtcgccttaaatcatttatggaaaaccggcttgagc
accgggcaacttgccgaactgggcttaaccctcggcgcggatgtaccgattttcgtgcac
ggcaaagcggcgtttgcggaaggcataggcgaaaaaatcacacactgcgaaccgccggaa
aaatggtatctggtgctcaagccgaatgtgtctatttccactgccgttgtgttctctgac
ccgcacttgccacgtaatacaccgaaaaaatcgctgtcacaattattgatgggaaaatac
gcaaacgattgtgaaaaagttgtgcgagatcattattcagaggttgaagagtcactaaac
tggttggtaaaatatgcaccggccagattaaccgggactggtgcttgcgtttttgcggaa
tttgatgataaaaaatctgcccaatcagttctccaagccaaaccaaaaaattgttttggt
ttcgtcgcaaaaggattaaatcattctcccttgcatgaaatgttgaaaaacgtgcctgat
tcaacgaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system