KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_00535Help
Entry
D7S_00535         CDS       T02046                                 

Definition
oxidoreductase domain-containing protein
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aan00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    D7S_00535
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D7S_00535
   00620 Pyruvate metabolism
    D7S_00535
   00650 Butanoate metabolism
    D7S_00535
  Lipid metabolism
   00071 Fatty acid degradation
    D7S_00535
  Amino acid metabolism
   00350 Tyrosine metabolism
    D7S_00535
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    D7S_00535
   00626 Naphthalene degradation
    D7S_00535
Enzymes [BR:aan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     D7S_00535
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     D7S_00535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
526206..528782
Genome map
AA seq 858 aa AA seqDB search
MLWLKKVLVALEEFRQLNQEQLNYIVAKASVAALDQHGVLAMHAYEETGRGVFEDKATKN
LFACEYVVNNMRHLKTVGVISENDVTGITEIADPVGVICGITPTTNPTSTAIFKSLIALK
TRNPIIFAFHPSAQQSSAHAARIVYEAAIAAGAPKNCIQWIEKPSMEGTSALMKHPGIAT
ILATGGNAMVEAAYSCGKPALGVGAGNVPAYVEKSANLKQAVHDIVMSKSFDNGMVCASE
QAAIVDEEIYNDFVKEMLSYGVYMVNKKEKAMLEEFMFGAKANSKNCGGAKLNANVVGKP
AAWIAEQAGFKVPPRTNILLAECKEVGEKEPLTREKLSPVLALIKSTSREDGLEKAEQMV
EFHGLGHSAAIHTSDAELAKEFGKRVKAIRVIWNSPSTFGGIGDVYNAFLPSLTLGCGSY
GKNSVGNNVSAVNLINIKRVGRRRNNMQWFKVPSKIYFERDSIQYLQSMGGMERVVIVTD
RTMVDLGFVEKIAHQITARGNHVTYQLFADVEPDPSIETVRRGTELIRNYKPDTIIALGG
GSAMDAAKVMWLFYEQPEVDFRDLVQKFMDIRKRAFKFPQLGRKARFIGIPTTSGTGSEV
TPFAVITEGNKKYPIADYSLTPTVAIVDPALVITVPAHVAADTGLDVLTHATEAYVSILA
SDFTDGLALQAIKLVFEFLEKSVTEKDPEARERMHNASTMAGMAFANAFLGMNHSLAHKI
GGRFHTPHGRTNAILMPHVIRYNGTRPEKTATWPKYNYYKADVKYQDIARMLGLPCSTPE
EGVRSYAQACYDLAVRCGIKMSFKEQGLDEKAWMDARRDVALLAFEDQCSPANPRLPMVT
DMEDILTRAYFGYDPKDY
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgctctggttgaaaaaggttttggttgcgctggaagaattccgccaattaaaccaagag
cagctgaactacattgtggcgaaagcctctgtggcggcgctggatcaacatggtgtgctg
gcaatgcacgcttatgaagaaaccgggcgcggcgtatttgaagataaggcgaccaaaaat
ttattcgcctgtgaatatgtcgtgaacaatatgcggcatttaaaaaccgttggcgtaata
agtgaaaatgatgtaacaggcatcaccgaaatcgccgatcctgtgggcgtcatctgtggg
atcaccccgacaaccaacccgacatccaccgccattttcaagtccctcattgcgctaaaa
acccgtaacccaatcatttttgccttccacccctccgcccaacaatcttccgcgcacgcc
gcccgcattgtgtatgaagctgctattgccgccggtgcgccgaaaaattgtattcaatgg
atcgaaaaaccatctatggaaggcacatccgcattaatgaaacacccgggcatcgccacc
atccttgccaccggcgggaacgccatggtagaagctgcttattcctgcggcaaaccggca
ttgggcgtcggtgcaggtaacgtgccggcgtatgtggaaaaatccgccaacttaaaacaa
gcagtgcacgacatcgtgatgtcaaaatctttcgataacggcatggtgtgcgcctccgaa
caggcggccatcgtcgatgaagaaatctataacgattttgtaaaagaaatgctttcttac
ggcgtttatatggtgaacaagaaagaaaaagccatgctggaagaattcatgttcggcgca
aaagccaacagcaagaactgtggcggtgcgaaactgaatgccaatgtggtgggtaaacct
gccgcgtggattgcggaacaggcgggcttcaaagtgccaccgcgaaccaatattctgctt
gccgaatgtaaagaagtgggcgaaaaagagccgttaacccgtgaaaaactctctccggta
ctggctttaattaaatccacttcccgtgaagacggtcttgaaaaagcggaacaaatggtg
gaattccatggtttgggtcactccgccgccattcacacctccgatgcggagcttgccaaa
gaatttggtaaacgggtgaaagccattcgcgttatctggaactcgccttccaccttcggc
ggtatcggtgatgtgtataacgccttcctgccttcccttacgttaggttgtggttcttat
ggtaaaaattccgtgggcaacaacgtaagtgcggtcaatttaattaacattaaacgagta
ggcagacggagaaacaatatgcaatggtttaaagtgccgtcaaaaatctattttgaacgg
gattcaattcaatatcttcaatccatgggtggcatggaacgcgtggttatcgtgaccgac
cgtaccatggtggacttaggtttcgtagaaaaaatcgcccaccaaattacggctcgtggc
aatcacgtaacctaccaattatttgccgatgtagaaccggatccgtccattgaaaccgta
cgccgtggtacggagttaatccgtaactataaaccggataccattatcgccctgggtggt
ggttcggcaatggatgcggcaaaagtgatgtggttattctatgaacaaccggaagtggat
ttccgcgatttggtacagaaattcatggatatacgtaaacgcgcgttcaaattcccgcaa
ctaggtcgtaaagccagatttatcggtattccgacaacatccggtaccggttctgaagtg
acaccgtttgcggttatcaccgaaggtaataaaaagtacccgattgccgactactcgctt
accccgaccgtcgccattgtggatccggcattagtgatcactgtaccggcacatgtcgcc
gccgacaccggcttggacgtattaacccacgccaccgaagcttatgtatccattcttgcc
agcgacttcaccgatggtcttgcactgcaagccattaaactggtgtttgagttcctggaa
aaatccgtgaccgaaaaagatccggaagcgcgcgaaagaatgcacaacgcctccaccatg
gcaggtatggcattcgccaatgcgtttttagggatgaaccactcccttgcccacaaaatc
ggcgggcgtttccatacaccacacggacgcaccaacgcgattttaatgccgcacgtgatt
cgttataacggtacccgtccggaaaaaactgctacgtggccgaaatataattactacaaa
gcggatgtaaaataccaagacatcgcccgtatgctcggcttgccttgcagcacaccggaa
gaaggcgtacgttcttacgcccaagcctgctacgatttagcggtgcgttgtggcattaag
atgtctttcaaagaacaaggcttggatgaaaaagcgtggatggatgcccgtcgtgatgtg
gcactgctcgcctttgaagaccaatgttccccggcaaaccctcgtttaccgatggttacc
gatatggaagacatcctcacccgcgcttattttggttatgatccaaaggattattaa

DBGET integrated database retrieval system