KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_00633Help
Entry
D7S_00633         CDS       T02046                                 

Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:aan03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(622856..623470)
Genome map
AA seq 204 aa AA seqDB search
MIGHLTGILMEKQPPEILLDVQGIGYELLLPMTSFYNLPEVGKQTRLFTHLVVREDAHLL
FGFAQKADRTLFRELIKTNGVGPKLALAILSAMSVDEFAYAIEREELSRLVKIPGIGKKT
AERLLVELKGKFKEVKTNDFFVQADHLPRFSTEISATVEPSNEAVAALVALGYKPLDAEK
MVKKVSKPELSSEQIIREALKAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgattggtcatctcactggtattttaatggaaaaacagccgccggaaattttgttggat
gtgcaaggtatcggctatgaactactgctgccgatgacaagtttttataacttgccggaa
gtaggcaaacaaacccgtttatttactcatctggtggtacgtgaggatgcccatttgttg
tttggatttgcccaaaaagccgaccgcactttattccgcgaactgataaaaaccaatggt
gtcgggcccaaattggcgctggcgattttgtctgccatgtcggtagatgaatttgcttat
gctattgaacgcgaggaactctcccgtttggtaaaaattcccggtatcggcaagaaaacc
gccgaacggttattggtggagttaaaaggcaaatttaaagaagtaaaaacaaacgacttc
ttcgtgcaggcggatcatttacctcgttttagtacggaaatatcggcgacggttgaaccg
tccaacgaagcggtagcggcgctcgtggcattaggttataaaccgttagacgcggaaaaa
atggtgaagaaagtttccaaacctgaactttccagcgaacagatcattcgtgaagctctg
aaagcggcattataa

DBGET integrated database retrieval system