KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_00730Help
Entry
D7S_00730         CDS       T02046                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:aan00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    D7S_00730
Enzymes [BR:aan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     D7S_00730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
703328..704260
Genome map
AA seq 310 aa AA seqDB search
MCAKLVVLGSVNADHVIRVPRFARAGETLRGSGYRIAYGGKGANQAVAAARLKDPNTQVD
FIACLGNDDIGRAMKAAFAKDGINTATITQIEQEMTGVAMIQVADNGENSIVISAGANAC
LDEHLVSCYAVHIQQADALLMQLETPLSAICKAAQIAKQNGTKVILNPAPAQALPEELLR
QLYMITPNETEAEILTGIKVEDKISAAQAAKRFHQLGVQIVLITLGAKGVYFSENGQGQI
IGGFRVKARDTTAAGDTFNGALVVALLEGKTLTNAIRFAHAAAAISVTREGAQPSIPHRA
ETLDFLAQQP
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgctaaactcgttgtactcggcagcgttaacgccgatcatgtgattcgtgtcccg
cgttttgcccgtgccggtgaaacgttacgcggctccggttaccgcattgcttacggcggc
aaaggcgccaatcaggcggtagctgccgcgcggttaaaagacccaaacacgcaggtggat
tttatcgcctgccttggtaacgatgacataggtcgtgccatgaaagccgcttttgcaaaa
gacggcattaacacggcgaccataactcaaattgagcaggaaatgacgggggtcgctatg
attcaagtggcggacaacggcgaaaacagcattgtaattagcgccggtgccaatgcgtgt
ttggacgaacatctcgtttcctgttatgccgtgcatattcaacaagcggatgccttgtta
atgcagctggaaacccctctttcggcaatttgtaaagcggcgcaaatcgccaaacaaaac
ggtacaaaagtgattcttaatcctgcgccggcgcaagcattaccggaagaattgctccgg
cagttatatatgattacaccgaatgaaacggaagcagaaatcctgacgggcattaaagtg
gaagataaaatctcggcagcacaggcggcaaaaagattccatcagctgggcgtgcaaatc
gtgcttattaccctgggtgccaaaggggtttatttcagtgaaaatggtcaggggcaaatt
atcggcggttttcgcgtaaaagcgagagacaccacggcagcaggcgataccttcaacggt
gcgttggtggttgccttgctggaaggaaaaacattgacgaatgccattcgcttcgcccac
gcagcggcggcaattagcgtcacccgtgaaggcgcccagccttcgattccgcatcgcgcg
gaaactttggattttctggcacagcagccttaa

DBGET integrated database retrieval system