KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_00794Help
Entry
D7S_00794         CDS       T02046                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    D7S_00794
Enzymes [BR:aan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     D7S_00794
Exosome [BR:aan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   D7S_00794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(763158..764180)
Genome map
AA seq 340 aa AA seqDB search
MTQQIFTGFPTRRLRRMRRQDFSRRLMAEHKLTVDDLIYPVFIIEGENHREAVPSMPNVE
RLTLDQLLIEAGLLVKYDVPVIALFPVVEQTKKSLMAEEAYNPNGLVQRAVKTLKAAYPE
LGVLTDVALDPYTVHGQDGIIDENGYVLNDITTEVLIKQALSHAEAGADVVAPSDMMDGR
IGRIRYALEENGFINTLIMAYSAKYASNYYGPFRDAVGSSGNLKGGDKKTYQLDPANSDE
GLQEVALDLEEGADMVMVKPGMPYLDLVYRVKQQFGVPTFAYQVSGEYAMHMAAIQNGWL
KEKECIMESLLCFKRAGADGILTYFAKQVAEWLYLEGKNK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaacaaattttcaccggttttcctacccgccgtttacgccgcatgcgtaggcag
gactttagccgtcgcttaatggcggaacacaaactgactgttgatgatctgatttatccc
gtatttattattgaaggcgaaaatcaccgcgaagccgtgccttccatgccgaatgtagaa
cgtttaaccctcgatcagctgttaattgaagcgggattattggtgaaatacgacgtgccg
gtcatcgctctgttccccgtggtggagcaaactaaaaaatccctcatggcggaagaggcc
tataatccgaacggcttggtgcaacgcgcggtaaaaaccttaaaagccgcgtatcccgaa
ctgggtgtattaaccgatgtggcgcttgacccttacaccgtacacgggcaagacggcatt
atcgacgagaatggctatgtattgaatgacatcaccaccgaagtgttaatcaaacaagcc
ctttcccacgcggaagccggcgccgatgtggtggcaccaagtgacatgatggacggtcgc
atcggcagaatccgctatgcactggaagaaaacggctttatcaataccctcatcatggca
tattccgccaaatacgcctctaactattacggcccgttccgcgacgcggtgggttcttcc
ggtaatttaaaaggcggcgataaaaaaacttaccaactggatcccgccaacagcgacgaa
ggcctgcaggaagtggcattagacttggaagagggcgccgatatggtgatggtcaaaccg
ggcatgccgtatttggatttggtctatcgtgtaaaacaacaattcggtgtaccgaccttc
gcttaccaagtctccggcgaatacgccatgcacatggcagccattcaaaacggctggctg
aaagaaaaagaatgtattatggaatcgctgctctgcttcaaacgcgccggcgccgacggc
attctgacttacttcgctaaacaagtggcggaatggttgtatttggaaggaaagaataag
tag

DBGET integrated database retrieval system