KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_00812Help
Entry
D7S_00812         CDS       T02046                                 

Definition
3',5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aan00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    D7S_00812
Enzymes [BR:aan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     D7S_00812
Transfer RNA biogenesis [BR:aan03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    D7S_00812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
778466..779275
Genome map
AA seq 269 aa AA seqDB search
MPILTTHLLQDVIEIAQQAGEHLRCFYQRSVTVRMKEDNTPVTEADLFVSQFLTEKLTAL
TPQIPILSEENCHIPLTERQTWRSYWLIDPLDGTQQFINRTGQFSVLISLVKDHQPVLGV
IHAPMLGSTYYAMQGFGAYKHHDGQHLKLTFHDIQADNALRIAVGSAAAAEKVRSILNKN
LAYEFHICGSSGLKSTLVADGVCDCYIRLGCTGEWDTAASEILLAEMGGIIFDLNYQPLT
YNKRESFVNPNFVMGITQDFPWDKIFHSN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcctcacgacccatttattgcaggatgtaatagagatcgcccaacaggcgggt
gagcatttacgttgcttttatcaacgttcggtgacagttcgaatgaaagaagacaacaca
ccggtgaccgaagcggatttattcgtcagccaatttttaacggaaaaactgaccgcactt
acgccgcagattccgattctttctgaagaaaattgccatattccgctgaccgagcggcaa
acctggcgttcttactggttaatcgatcccctggacggcacgcaacaatttatcaatcgc
accggtcaattctccgtgctcatcagtttggtgaaagatcatcaaccggtgttgggcgtg
attcatgcgccgatgttgggttccacctattacgccatgcaaggtttcggtgcgtataaa
caccatgacgggcagcaccttaaattaaccttccatgatattcaagcggacaatgccttg
cgtattgctgtgggttccgccgccgcagccgaaaaagtgcggtcgattttaaataagaat
ttggcttacgaatttcatatttgcggatccagcgggttaaaaagcacactggtggcagac
ggcgtatgcgattgctacattcgcttgggttgcaccggtgaatgggatactgccgcttcc
gagattttactggcggaaatgggtggcattatttttgacttgaattatcaaccgctgact
tataataaacgggaatctttcgtcaatccgaattttgtcatgggaatcacgcaggatttt
ccgtgggataaaatctttcactccaattaa

DBGET integrated database retrieval system