KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_00931Help
Entry
D7S_00931         CDS       T02046                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aan00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    D7S_00931
Enzymes [BR:aan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     D7S_00931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(888694..889977)
Genome map
AA seq 427 aa AA seqDB search
MAYCVFSYTGTFILLPDKSAKCGQNFMQNKQKVVILGATGSIGNSTLSVIEHNPENYEAF
ALVGGSNAAAMFEKCLKFRPHFVALADESAAKILREKVAAHQLPTQVLAGQQAICELSAH
PDADMVMAAIVGATGLLPTLSAVKAGKKVLLANKEALVTCGQIFIDAVKQYGARLLPVDS
EHNAIFQALPPQAQQQIGFCPLADLGISKIVLTGSGGPFRYTALSEFDGITPEQAVAHPN
WSMGKKISVDSATMMNKGLEYIEARWLFNASADEMEVIIHPQSIIHSMVRYIDGSVIAQM
GNPDMRTPIAETMAYPHRTFSGVAPLDFYQLNGLTFLAPDYLRYPCLQLAIEAFAAGQYA
TTAMNAANEIAVQAFLDRQIKFTDIAKLNQAVVEQIAPQQIKQIDDVLDVDRAARECARK
QLAHWSH
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtggcttactgcgtcttttcttatacgggcactttcattttattgcccgataaatctgca
aagtgcggtcaaaattttatgcaaaacaaacaaaaggtcgtgattctcggtgccacaggt
tctatcggcaacagcaccctttcggtgattgaacacaatccggaaaactatgaggcgttc
gcgttagtgggcggttccaatgcggcggcgatgtttgaaaaatgcctgaaatttcgaccg
cactttgtcgctttagccgatgaaagtgcggcaaaaatattgcgtgaaaaagtggcggca
catcagcttccaacccaagttttagcagggcagcaggcaatttgtgaattgagtgcgcat
cccgatgcggacatggtgatggcggcgattgtaggggcgacgggcttattgccgaccttg
tctgcggtcaaagcgggtaagaaagtgttgctggcgaacaaagaggcgctggtgacttgc
ggtcagatttttattgatgccgtaaaacaatatggtgcgcggttattgccggtggacagc
gaacataacgccattttccaagcgttaccgccacaggcgcagcaacaaatcggcttttgt
ccgttggcggatttaggcatcagcaaaatcgtgttgaccggttccggcgggcctttccgt
tatacggcgttaagcgaattcgacggcattacaccggaacaggcggtggcacatccgaac
tggtctatgggcaagaaaatttccgtggattccgccaccatgatgaacaaagggttggaa
tacattgaagcccgttggctgttcaatgcgtccgccgacgaaatggaagtgattattcac
ccgcaatccattattcattctatggtgcgttatatcgatggtagcgtcattgcgcaaatg
ggcaatcctgatatgcgcacgccgatcgccgaaaccatggcgtatccgcaccgcactttt
tccggcgtcgcgccgttagatttctatcaattaaacgggctgacttttttagcgccggat
tatctgcgttatccttgtttgcaactcgctattgaggcttttgccgccggtcaatatgct
acgacggcaatgaatgccgccaatgaaatcgctgtgcaggcatttttagatcgccaaatt
aaatttaccgacattgccaaacttaatcaggcggtggtggaacaaatcgcgccgcaacaa
atcaaacaaattgatgatgtgttggacgtcgatcgcgcagcgcgtgagtgcgcgcgtaaa
caattggcacattggtctcactga

DBGET integrated database retrieval system