KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_01020Help
Entry
D7S_01020         CDS       T02046                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aan00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    D7S_01020
   00052 Galactose metabolism
    D7S_01020
   00500 Starch and sucrose metabolism
    D7S_01020
   00520 Amino sugar and nucleotide sugar metabolism
    D7S_01020
Enzymes [BR:aan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     D7S_01020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
979875..980762
Genome map
AA seq 295 aa AA seqDB search
MKAIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECVAAGIKEIVLVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLEEVRSIVPKNVTIMHVRQGNAKGLGHAVLCGRPLVGN
EPFAVVLPDVLLAEFSANQKKENLALMLKRFKQTQASQIMVNPVKPEEVSSYGIADCGGV
EIPPGESAKIDSIVEKPSVDEAPSNLAVVGRYVFSATIWDLLEKTPVGVGDEIQLTDAID
MLIDKETVEAFHMTGISYDCGDKIGYMKAFVEYGLHHNKLAGEFKAYLKDLVKTF
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgattattcctgttgcaggcttaggtacacgtatgttacctgctactaaagcc
attccgaaagaaatgttaactttagtggataaaccgctaatccaatatgtggtaaatgaa
tgtgtcgccgccggtattaaagaaatcgtcctggtgactcattcctcaaaaaatgccata
gaaaaccattttgatacttccttcgaattggaaacgatgctggaaaaacgcgtaaaacgc
caattattggaagaagtgcgttccatcgtgcccaaaaatgtcacaatcatgcacgttcgc
caaggcaatgcgaaagggttggggcacgccgtattgtgcggtcgtccgctggtgggtaac
gagccttttgccgtggtgttgccggatgtgttgctggccgagttttccgctaatcagaaa
aaagaaaatctggcgttaatgttaaaacgctttaaacaaacccaagccagccaaatcatg
gtgaacccggttaaacctgaagaagtcagcagttacggtatcgccgactgtggtggtgtg
gaaattcctccgggtgaaagtgccaaaattgatagtatcgtggagaaaccaagtgtggat
gaagcaccgtctaatttggctgttgtagggcgttatgtgttctcggcaaccatttgggat
ttattggaaaagaccccggtgggcgtgggcgatgaaatccagttaaccgatgctattgat
atgctgattgataaggaaaccgtcgaagccttccacatgacaggcatttcttacgactgc
ggcgataaaatcggttatatgaaagcctttgtggagtacgggctgcaccacaataaactt
gcgggtgaatttaaagcttacctcaaagatttggtgaaaacattttaa

DBGET integrated database retrieval system