KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_01173Help
Entry
D7S_01173         CDS       T02046                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:aan00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    D7S_01173
  Amino acid metabolism
   00330 Arginine and proline metabolism
    D7S_01173
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    D7S_01173
Enzymes [BR:aan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     D7S_01173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
join(1106030..1106206,1106208..1106849)
Genome map
AA seq 272 aa AA seqDB search
MQQNNKTIVVKFGTSTLTQGSPKLNLAYMMEIVRQLAQLHQAGFRLVIVTSGAIAAGRHN
YLNHPQLPPTVASKQLLAAVGQSQLIQTWEKLFAIYDIHIGQMLLTRADIEDRERFLNAR
DTLHALLDNRIIPVINENDAVATAEIKVGDNDNLSALMAILVQADRLENRKQWLFTAPSA
GVLTIDEGAQSAVLIQHKSLLPAGIVSVSGRFSRGEVVRIRNAQGKDIALGMPRYNSDAL
ELIKGKQSQDIEQQLGYEYGAVAIHRDDMIVL
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcaacagaataataaaaccattgtggtgaaattcggcaccagcacgctcacgcagggc
tcgccgaaattgaatttagcctacatgatggaaattgttcgtcagttggcacaattacat
caggcaggttttcgcctggtgatcgtgacttcgggtgccattgccgccggtcgccataat
tatttaaatcacccgcaattgccacccaccgtggcgtccaaacaattgctggcagcagtg
gggcagagccagctgattcaaacctgggaaaaactgtttgccatttatgatattcacatc
gggcaaatgttgctgacccgcgccgatattgaagatcgcgaacgtttcctgaatgcacgc
gataccttgcacgcgttgctggataaccgcattattcccgtgatcaacgaaaatgatgcg
gtggcaacggcagaaattaaagtgggggataacgataatttatcagcgctgatggcgatt
ttggtgcaggcggatcgtttggaaaaccgtaaacaatggctgttcaccgcgccgtcggcg
ggcgtgctgaccattgatgaaggcgcacaaagtgcggtgttaattcagcataaatcttta
ctgccggcgggcattgtgagtgtcagcggacgtttctcacgcggtgaagtggtgcgcatt
cggaatgcacaaggcaaggacattgccctcggcatgccgcgctataacagcgatgcgctg
gaactgattaaaggcaaacaatcgcaggatattgaacaacagctgggctatgagtacggc
gcggtggctattcatcgggacgatatgatcgtgttataa

DBGET integrated database retrieval system