KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_01308Help
Entry
D7S_01308         CDS       T02046                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aan00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    D7S_01308
   00051 Fructose and mannose metabolism
    D7S_01308
Enzymes [BR:aan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     D7S_01308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1227728..1229047
Genome map
AA seq 439 aa AA seqDB search
MTNYFNNIDKVRYEGPDSTNPFAYKYYDANQVILGKTMAEHLRLAVCYWHTFCWNGTDMF
GLGSLDRSWQKNAGTLEAAKQKADIAFEFFTKLGVPYYCFHDVDVAPEGNSIKDYIHNFN
TITDILERKQAETGVKLLWGTANCFSHPRYMSGASTNPNPEVFAWAATQVYHAMNATKRL
GGENYVLWGGREGYETLLNTDLKREREQIGRFMQMVVEHKHNIGFNGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLENEIKVNIEANHATLAGHTFQHEVATAFALDIFGSIDANRG
DPQPGWDTDQFPNSVEENTLVMYEILKNGGFTTGGFNFDAKIRRQSTDPYDLFYAHIGAI
DVLALSLKRAAQMLEEQRLQQLVDERYAGWRQSLGQQILQGNASLAQLAQVVEQQGLDPQ
PVSGKQEYLENLVNGYIYR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgacaaactacttcaacaacattgacaaagttcgctacgaaggtcctgactcaaccaat
cctttcgcgtataaatactacgacgccaatcaggtcattcttggcaaaaccatggcggag
catttgcgtttggcggtatgttattggcatacgttttgctggaacggtaccgatatgttc
ggcttgggttcactggatcgcagctggcagaaaaatgccggcacgttagaggcggcaaaa
caaaaagcggatattgcttttgagtttttcaccaaattaggcgtgccttattattgtttc
cacgatgtggatgtggcgccggaaggcaattccattaaggattacattcataatttcaac
acgataacggacattcttgaacgtaaacaggcggaaaccggcgtaaaattgctgtggggt
acggcaaactgtttcagccatccgcgttatatgtccggtgcctctaccaacccgaatccg
gaagtgttcgcgtgggcggcaacgcaggtatatcacgccatgaatgccaccaagcgtttg
ggcggcgaaaactatgtgctctggggcggtcgcgaaggttatgaaaccctgctcaatacg
gatttaaaacgtgaacgcgaacaaatcggacgcttcatgcaaatggtcgtggaacataaa
cataacatcggctttaacggcacattgcttatcgaaccgaaaccgcaagaaccgaccaaa
caccaatacgattatgacgtggcaacggtttacggtttcttaaaacaattcggcttggaa
aatgaaattaaagtgaacattgaagccaaccacgccaccttggcggggcataccttccag
catgaagtggcaacggcgttcgcgctggatattttcggctccatcgacgccaaccgcggc
gacccgcaaccaggctgggacaccgaccaattcccgaacagcgtggaagaaaacacgttg
gtgatgtacgaaatcctgaaaaacggcggctttaccaccggcggtttcaactttgatgcg
aaaatccgccgtcaaagtaccgatccttatgatttgttctatgcccatatcggcgctatc
gacgtgttggcgttatccctcaaacgggcggcacaaatgctggaagaacaacggctgcaa
cagcttgtggacgaacgttatgccggttggcggcaatccctcggtcagcaaattttgcag
ggtaacgcttctttggcacagctcgcgcaggtggttgagcaacaaggcttggatccgcaa
ccggtgtccggtaaacaggaatatttggaaaatttggtgaacggttacatttaccgttaa

DBGET integrated database retrieval system