KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_01476Help
Entry
D7S_01476         CDS       T02046                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:aan00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    D7S_01476
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    D7S_01476
Enzymes [BR:aan01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     D7S_01476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1381719..1383185
Genome map
AA seq 488 aa AA seqDB search
MHRLTALLGIDIAGDINLTEMTLDSRTAKAGCLFIAIKGHQTDGRQYIPQALHNGASAVI
FEADSAQQHLQVHYEQGIPLIAFYRLSENLSRLADVFYQYPSKHLTLVGVTGTNGKTTTA
QLLAQWTQLLGHTGAVMGTIGNGLVGQVKEAANTTGSAVEIQSSLADFVAKGADFAAIEV
SSHGLVQHRVESVHFSAAVFTNLSRDHLDYHHTMENYAAAKKRLFTELDSRYQIIDADDP
VGAVWLAEMPHAVAVSAKADFLPQQANWLKAVDVRFNHKGATIQFESSWGNGELQSPLIG
AFNVSNLLLVTATLLTLGYPLSGLINSVHKLTGVCGRMEILHAPQKPTVIVDYAHTPDAL
EKALQAARLHCRGKLWCIFGCGGDRDSGKRPLMARIAEQLADHVIATDDNPRTEEPKKIM
ADILNGFVHPQSVQVIHQRAQAIATAIKSAVENDVILIAGKGHEDYQIIGKTKYHFSDQE
VARNYLSQ
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgattaaccgcacttttagggattgatattgccggagacatcaaccttaccgaa
atgacattagacagccgtactgcaaaggccggctgtctttttattgccattaaagggcac
caaaccgacggtcgccaatacattccgcaagccttacacaacggcgcaagtgcggtcatt
tttgaagccgattctgcacagcaacatcttcaggttcattacgaacaggggattcctctc
attgccttttatcggctaagcgaaaatttatcccgtctcgccgatgtgttttatcaatat
ccttccaaacatttaaccctagtgggcgtaacgggtaccaacggcaaaactacaactgcc
caattattggcacaatggacgcaactgttaggacacaccggtgccgtgatggggacgatt
ggtaacggcttagtcggtcaggtaaaagaagccgctaataccaccggttccgctgtcgag
attcaatcttcgctggcggatttcgtcgcaaaaggggcagactttgcggcgattgaagtg
tcttcccatggtttggtgcagcatcgcgtagaatccgtgcatttcagcgcggcggtgttt
accaatttaagccgcgatcatttggattatcatcacactatggaaaattacgcagcggca
aaaaaacgcctgtttaccgaactggatagtcgttatcagattattgacgcggatgatccc
gtcggtgcggtgtggttggcggaaatgcctcatgctgtggcggtcagcgctaaggcggat
tttctcccgcaacaagccaactggctgaaagctgtcgatgtgcgttttaatcacaaaggt
gcaacgattcagtttgaatcctcctggggcaacggcgaattacaaagcccacttatcggc
gcgtttaatgtgagcaatttattgttggtgaccgcaaccttgctaacgctcggttatccc
ttatccggcctcattaacagcgtacataaattaaccggcgtatgtggccgtatggaaata
ctacacgcaccacaaaaaccgactgtgattgtggattatgcacatacacccgacgcattg
gaaaaagccttacaggcggcacggctacattgccgtggtaaactttggtgcatttttggc
tgtggcggcgatcgtgacagcggtaaacgcccactaatggcaagaattgccgagcagttg
gcggatcatgttattgccaccgacgacaatccacgcacggaagaaccgaagaaaatcatg
gcggatattttaaacggttttgtccatccgcaaagcgtgcaagttattcatcagcgtgca
caagccattgctaccgcgataaaaagtgcggtggaaaatgacgttattttaattgccggt
aaagggcacgaagactatcagattatcggcaaaaccaaatatcatttttccgatcaggaa
gtggctcgtaactatttatctcaataa

DBGET integrated database retrieval system