KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_01491Help
Entry
D7S_01491         CDS       T02046                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aan00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    D7S_01491
  Amino acid metabolism
   00300 Lysine biosynthesis
    D7S_01491
Enzymes [BR:aan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     D7S_01491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1400039..1401172
Genome map
AA seq 377 aa AA seqDB search
MKEKVVSLAQALIRRPSISPNDEGCQQLIAERLEKLGFQIEWLPFNDTLNLWAKHGSGDP
VIAFAGHTDVVPTGDESQWTYPPFDAKIVDDMLYGRGAADMKGSLAAMVVAAEEYVKAHR
NHQGTIALLITSDEEAAAKDGTVRVVETLMARGEKITYCMVGEPSTSQILGDVVKNGRRG
SITGNLYIQGIQGHVAYPHLAENPIHNAAPFLQELTTYQWDNGNDFFPPTSLQIANIHAG
TGSNNVIPGELYVQFNLRYCTEVTDGMIKQKVAEMLEKHGLKYRIEWNLSGKPFLTKPGK
LVSALVDSLQQIAGITPKLETGGGTSDGRFIALMGAEVVEFGPLNATIHKVNECVSVEDL
GKCGQIYHQMLVNLLEH
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaagttgtctctttggcgcaagcattaatccgtcgtccttccatcagcccg
aatgacgaaggctgccagcagctgattgcagaacggttagaaaaactcggttttcaaatt
gaatggctgccttttaacgacacgctcaatttatgggcgaaacatggcagtggcgatcct
gtcattgcctttgccgggcatacggatgtggtgccgacgggcgatgaaagccaatggact
tatccgcctttcgacgcaaaaattgtggacgatatgctttatggacgcggtgcggcggat
atgaagggatcgctggcggcaatggtggtggcagcggaagaatatgtaaaagcccatcgg
aatcatcaaggcactatcgcgttgttaattacctctgatgaagaagctgccgcgaaagac
ggcacggtgcgcgtggtggaaaccttaatggcgcgtggcgaaaagatcacttattgcatg
gtgggcgagccttccacttcacaaatcttgggcgatgtggtgaaaaacggtcgccgcggt
tccattacgggcaatttgtatattcagggcattcaagggcacgtcgcctatcctcatctg
gcggagaatcctattcacaacgccgcgccgttcttgcaggagctcaccacataccaatgg
gacaacggcaatgacttttttcctccaaccagtctgcaaatcgctaatattcatgccggc
accggcagcaataatgtgattccgggcgagctttatgtgcaatttaatttgcgttattgc
acggaagtgacggacgggatgattaagcagaaagtcgccgagatgctggaaaaacacggg
ctgaagtatcgtattgaatggaatctttccggcaagccgtttttaaccaaaccgggaaaa
ctggtgagtgcgttggtggacagcctgcaacaaatcgcaggcattacgccgaaattggaa
accggtggtggcacctcagacggacgttttattgcgctcatgggcgcggaagtggtggaa
ttcggaccgcttaacgctactattcataaagtgaacgagtgcgtgagcgtggaagatctt
ggcaaatgcggtcagatttaccatcaaatgttagtgaatttattggaacattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system