KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_01513Help
Entry
D7S_01513         CDS       T02046                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aan00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    D7S_01513
DNA repair and recombination proteins [BR:aan03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      D7S_01513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1421441..1422043
Genome map
AA seq 200 aa AA seqDB search
MQTSPLLENLIESLRVLPGVGPKSAQRMAYHLLQRNRSGGMRLAQGLTEAMSKIGHCEHC
RTFTEEDVCNICSNPRRQNSGLLCVVETPADILAIEQTGQFSGRYFVLMGHLSPLDGIGP
REIGLDLLQKRLQTESFNEVILATNPTVEGDATANYIAELCLQQNVKVSRIAHGIPVGGE
LEMVDGTTLTHSFLGRREIG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagccccttgttagaaaatctgatcgaaagtttacgcgtattgccgggcgtc
ggtccgaaatccgcgcaacgtatggcgtatcatttattgcaacgcaatcgcagcggcgga
atgcgcttggcgcaagggctgacggaagcgatgtcgaaaatcgggcattgtgaacattgc
cgcacttttacggaagaagatgtgtgcaacatttgtagtaatccacgccgtcaaaattcg
ggcttgctttgcgtggtggaaacgccggcggatattcttgctattgagcaaacagggcag
ttttccgggcgttatttcgtgctgatggggcatttgtcgccgctggacggtatcggcccg
cgcgaaatcggcttggatttgttgcaaaaacgcctgcaaacggaatctttcaatgaagtg
attttagccactaacccgacggtagaaggcgacgccacagcaaactacattgcggaactt
tgcctacaacaaaacgtcaaagtcagccgtattgcccacggcattccggtgggtggcgaa
ttggaaatggtggacggcaccacgctgacccattccttcttaggtcgccgcgaaatcggc
taa

DBGET integrated database retrieval system