KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_01546Help
Entry
D7S_01546         CDS       T02046                                 

Definition
galactose mutarotase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:aan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D7S_01546
   00052 Galactose metabolism
    D7S_01546
Enzymes [BR:aan01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     D7S_01546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1451711..1452742
Genome map
AA seq 343 aa AA seqDB search
MLEQLTQGNAPDGLPFNLFTLKNAQGMCAQFTDWGAAWTSCCVPVNGELREVLLGCKLED
YPIQQAYLGVSVGRYANRIANAQFPLNGKVVRLTANQGKHQLHGGNGFDKRRWMLEKCGE
NFVCFSLHSTDGDQGFPGNVKATVTYTLTEDNAVKIEYAAQSDQDTALNLTNHAYFNLEN
AMQGADVRNHSLRLNADFYLPVDSEGIPNSPLKHVVGTGFDFRIAKPIKQDFLQGEQLAA
KGYDHSFIVNKAWQKPCVLLTSPNGDLSLEVLTSQAALQVYTGNFLAGTPTRENREYADY
SGIALETQCLPDTPNHPEWQNYGGIVKAGEEYYQWTEYRFKGN
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgctagaacagctcacacaaggcaacgcaccggacggcctgccgtttaacctgtttacc
ttaaaaaatgcgcaaggtatgtgcgcgcaatttaccgactggggcgcggcttggacttct
tgttgtgtgccggtcaacggcgaattgcgtgaagtgctgttggggtgcaaattggaagat
tatcccattcaacaagcctacttaggcgtgagcgtaggacgctatgccaatcgtatcgcc
aacgcgcaatttccgttgaatggcaaagttgtgcgtttaactgctaaccaaggtaaacac
cagctgcacggcggaaacggcttcgataaacgccgttggatgttagaaaagtgcggtgaa
aattttgtgtgtttttcattgcattccaccgacggcgatcaaggtttccccggcaatgtg
aaggcgacggtaacttacactttgacggaagataatgcggtaaaaatcgaatatgccgcc
caaagcgatcaggataccgcactgaatttaaccaatcacgcctatttcaatttagaaaat
gcgatgcagggcgcggatgtgcgcaaccatagcttgcgcctcaacgccgatttttattta
ccggtggatagcgaaggcattcctaactcgccgctcaaacatgttgtcggcaccggcttt
gatttccgcatagccaagccaattaaacaggatttcttgcaaggagaacagcttgctgcc
aaaggctacgaccattcttttattgtgaataaagcctggcaaaaaccttgtgttctgctc
acctccccaaacggtgatttaagcctggaagtgctgacttcacaagccgccttacaggtt
tacaccggcaacttcctcgctggcaccccaacccgcgagaacagggaatacgccgattac
agcggcatcgccctggaaacccaatgcctccccgacaccccaaaccaccccgaatggcaa
aattacggcggcattgtaaaagcaggcgaagaatattaccaatggacggaatatcgattt
aagggaaattaa

DBGET integrated database retrieval system