KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_01563Help
Entry
D7S_01563         CDS       T02046                                 

Definition
Chb protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aan00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    D7S_01563
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    D7S_01563
Enzymes [BR:aan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     D7S_01563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1466993..1468138
Genome map
AA seq 381 aa AA seqDB search
MNYIKKIILSLFLLGLFSVLNCCVKGNSIYPQKTSTKQTGLMLDIARHFYSPEVIKSFID
TISLSGGNFLHLHFSDHENYAIESHLLNQRAENAVQGKDGIYINPYTGKPFLNYRQLDDI
KAYAKAKGIELIPELDSPNHMTAIFKLVQKDRGVKYLQGLKSRQVDDEIDITNADSITFM
QSLMSEVIDIFGDTSQHFHIGGDEFGYSVESNHEFITYANKLSYFLEKKGLKTRMWNDGL
IKNTFEQINPNIEITYWSYDGDTQDKNEAAERRDMRVSLPELLAKGFTVLNYNSYYLYIV
PKASPTFSQDAAFAAKDVIKNWDLGVWDGRNTKNRVQNTHEIAGAALSIWGEDAKALKDE
TIQKNTKSLLEAVIHKTNGDE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaattatattaagaaaattattttatctcttttcctactgggactatttagcgtgttg
aattgttgcgtaaaaggcaattccatatatccgcaaaaaacaagtaccaagcagaccgga
ttaatgctggacatcgcccgacatttttattcacccgaggtgattaaatcctttattgat
accatcagcctttccggcggtaattttctgcacctgcatttttccgaccatgaaaactat
gcgatagaaagccatttacttaatcaacgtgcggaaaatgccgtgcagggcaaagacggt
atttatattaatccttataccggaaagccattcttgaattatcggcaacttgacgatatc
aaagcctatgctaaggcaaaaggcattgagttgattcccgaacttgacagcccgaatcac
atgacggcgatctttaaactggtgcaaaaagacagaggggtcaagtaccttcaaggatta
aaatcacgccaggtagatgatgaaattgatattactaatgctgacagtattacttttatg
caatctttaatgagtgaggttattgatatttttggcgacacgagtcagcattttcatatt
ggtggcgatgaatttggttattctgtggaaagtaatcatgagtttattacgtatgccaat
aaactatcctactttttagagaaaaaagggttgaaaacccgaatgtggaatgacggatta
attaaaaatacttttgagcaaatcaacccgaatattgaaattacttattggagctatgat
ggcgatacgcaggacaaaaatgaagctgccgagcgccgtgatatgcgggtcagtttgccg
gagttgctggcgaaaggctttactgtcctgaactataattcctattatctttacattgtt
ccgaaagcttcaccaaccttctcgcaagatgccgcctttgccgccaaagatgttataaaa
aattgggatcttggtgtttgggatggacgaaacaccaaaaaccgcgtacaaaatactcat
gaaatagccggcgcagcattatcgatctggggagaagatgcaaaagcgctgaaagacgaa
acaattcagaaaaacacgaaaagtttattggaagcggtgattcataagacgaatggggat
gagtga

DBGET integrated database retrieval system