KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_01660Help
Entry
D7S_01660         CDS       T02046                                 

Definition
triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    D7S_01660
   01230 Biosynthesis of amino acids
    D7S_01660
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D7S_01660
   00051 Fructose and mannose metabolism
    D7S_01660
   00562 Inositol phosphate metabolism
    D7S_01660
Enzymes [BR:aan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     D7S_01660
Exosome [BR:aan04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   D7S_01660
  Exosomal proteins of bladder cancer cells
   D7S_01660
  Exosomal proteins of melanoma cells
   D7S_01660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1555290..1556057
Genome map
AA seq 255 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTRELITGLKEELHGVTGCNVAIAPPVMYLAEAEAALVGSQI
VLGAQNVDVNVKGAFTGDISTEMLKDFGAKYIIIGHSERRTYHKESDEFVAKKFGALKEA
GLVPVLCIGESEAENEAGKTEEVCARQIDAVINLLGVEAFNGAVIAYEPIWAIGTGKSAT
PAQAQAVHAFIRGHIAKKSQAVADQVIIQYGGSVNDANAAELFTQPDIDGALVGGASLKA
PAFAVIVKAAAKAKN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtcgtcctttagttatgggtaactggaaattaaacggtagcaaagcgttcacc
agagaattaattaccggtttgaaggaagaattgcatggtgtgaccggttgtaatgtggca
attgctccgccggtgatgtatttggcggaagcggaagccgcgctggttggcagtcaaatt
gttttaggtgcacaaaacgttgatgtgaacgtgaaaggcgcattcaccggcgatatttct
accgaaatgttaaaagatttcggcgcgaaatatatcattatcggtcactccgaacgtcgt
acttatcataaagaaagtgatgaattcgtggcgaaaaaattcggtgcgttaaaagaagcg
ggcttggtgccggtattatgtatcggtgaatccgaagcggaaaacgaagcaggaaaaacc
gaagaagtgtgcgcccgtcaaattgatgcggtgattaatttattgggtgtggaagccttc
aacggcgcggtgattgcctatgaaccgatttgggcaatcggcaccggtaaatctgccact
ccggcgcaagcgcaagcggtacatgcattcattcgcggtcatatcgcgaaaaaatcccaa
gcggttgccgatcaagttattattcaatacggcggttccgtaaacgatgccaacgcggcg
gaattgttcacccaaccggatattgacggtgcattggtgggcggtgcgtccttaaaagcc
ccggcatttgcggttatcgtaaaagcagcggcaaaagcgaaaaactaa

DBGET integrated database retrieval system